Report for 2776.m00123

 > 2776.m00123, length: 941, copies: 2 

MTRYKPLVLPLMLILLHTQLIIVPSSSAATYANHTGALPPAVVPCLPDQASALLRLKRSFSITKNSSSTFGSWKA

GTDCCHWEGIHCRNGDGRVTSLDLGGRRLESGVESSVLKEPNFETLIANHKKLRELYLGAVDLSDNGMTWCDALS

SSTPNLRVLSLPNCGLSGPICGSFSAMHSLAVIDLRFNDLSGPIPNFATFSSLRVLQLGHNFLQGQTSFYGEIPS

SIGNLKYLKNLGVGASKLTKLRKLVLYECNFSGKLPQNISNFTNLSTLFLNSNNLVGTMKLASLWGLQHLRYLDI

SDNNLVVVDGKVDSSSTHIPKLQILALSGCNITKFPDFLRSQDELLWLDLSKNQIHGAIPSWAWESWNDSGVASL

ILAHNKFTSVGSNPFIPLQIDWLDLSNNMFEGTIPIPQGSARLLDYSNNMFSSIPFNFTAHLSHVTLFNAPGNNF

SGEIPPSFCTATELQYLDLSNNNFSGSIPSCLIENVNGIQILNLNANQLDGEIPDTIKEGCSFHALYFSGNRIEG

QLPRSLLACQNLEILDAGNNQINDIFPCWMSKLRRLQVLVLKSNKLFGHVVQSLTDEESTCAFPNAIIIDISSNN

FSGPLPKDKWFKKLESMLHIDTNTSLVMDHAVPSVGLVYRYKASLTYKGHDTTLAQILRTLVFIDFSNNAFNGSI

PEIVGELVLTHGINMSHNFLTGPIPSQLGGLKQLEALDLSSNQLSGVIPQELASLDFLEMLNLSYNKLKGKIPES

LHFLTFTNSSFLGNNDLCGPPLSKGCINMTILNVIPSKKKSVDIVLFLFSGLGFGLGLAIAVVVSWGIPIRKQAT

RHATERIRRGSDSGGRRSGNAALWEEERLVYGVYRPRRWATPWEGEKVHDEEDDLAVDRSEISPAPVEKSNGAGS

WPSITYTTPTGRATPAAARRSAAPPPLLDGSTIGPRSLAIL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	155	178	0.22
LRR [Pfam ls]	179	201	2.4
LRR [Pfam ls]	202	231	0.096
LRR [Pfam ls]	245	268	0.41
LRR [Pfam ls]	294	317	1.4
LRR [Pfam ls]	321	342	1.2
LRR [Pfam ls]	344	368	7.2
LRR [Pfam ls]	463	487	0.0034
LRR [Pfam ls]	536	559	2.9
LRR [Pfam ls]	708	731	0.19
LRR [Pfam ls]	732	755	0.075

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	93	117	3.1
LRR [sensitive, ls]	93	117	61
LRR [sensitive, ls]	155	178	0.011
LRR [sensitive, ls]	155	178	0.22
LRR [sensitive, ls]	179	201	0.12
LRR [sensitive, ls]	179	201	2.4
LRR [sensitive, ls]	202	231	0.0049
LRR [sensitive, ls]	202	231	0.096
LRR [sensitive, ls]	245	268	0.021
LRR [sensitive, ls]	245	268	0.41
LRR [sensitive, ls]	269	293	0.59
LRR [sensitive, ls]	269	293	12
LRR [sensitive, ls]	294	317	0.072
LRR [sensitive, ls]	294	317	1.4
LRR [sensitive, ls]	321	342	0.063
LRR [sensitive, ls]	321	342	1.2
LRR [sensitive, ls]	344	368	0.37
LRR [sensitive, ls]	344	368	7.2
LRR [sensitive, ls]	371	394	1
LRR [sensitive, ls]	371	394	20
LRR [sensitive, ls]	415	438	0.88
LRR [sensitive, ls]	415	438	17
LRR [sensitive, ls]	439	462	1.6
LRR [sensitive, ls]	439	462	31
LRR [sensitive, ls]	463	487	0.00017
LRR [sensitive, ls]	463	487	0.0034
LRR [sensitive, ls]	488	508	2.8
LRR [sensitive, ls]	488	508	55
LRR [sensitive, ls]	512	535	1.6
LRR [sensitive, ls]	512	535	31
LRR [sensitive, ls]	536	559	0.14
LRR [sensitive, ls]	536	559	2.9
LRR [sensitive, ls]	560	580	5.7
LRR [sensitive, ls]	560	580	110
LRR [sensitive, ls]	590	615	7.4
LRR [sensitive, ls]	590	615	150
LRR [sensitive, ls]	660	683	0.63
LRR [sensitive, ls]	660	683	12
LRR [sensitive, ls]	684	707	1.9
LRR [sensitive, ls]	684	707	38
LRR [sensitive, ls]	708	731	0.0094
LRR [sensitive, ls]	708	731	0.19
LRR [sensitive, ls]	732	755	0.0038
LRR [sensitive, ls]	732	755	0.075

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	9	662	4e-35
Cf-9 [L. pimpinellifolium]	45	814	2e-92
CLV2 [A. thaliana]	47	768	1e-51
FLS2 [A.thaliana]	80	769	7e-48
FLS2 [A.thaliana]	155	578	1e-38
FLS2 [A.thaliana]	160	769	1e-46
Xa21 [O. sativa]	163	769	7e-44
FLS2 [A.thaliana]	166	769	1e-56
FLS2 [A.thaliana]	308	802	8e-38
CLV2 [A. thaliana]	398	769	1e-28
FLS2 [A.thaliana]	522	770	9e-19
Xa21 [O. sativa]	658	788	8e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	794	816	out -> in

Report for 2776.m00123

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)