Report for 2842.m00110

 > 2842.m00110, length: 961, copies: 1 

MVEMQWLLLLFMLLVSLRLSFSQTNPQDVSALQALMKNWQNEPQSWMGSTDPCTSWDGISCSNGRVTEMRLSGIN

LQGTLSNAIDQLSSLTYLDLSNNLNLGGPLPPSIVNLKQLTTLILLGCSFTGDIPEQIGALRQLTFLALNSNKFT

GGIPPTLGLLSKLFWLDLSDNQLSGKIPVSSGSNPGLDQLVNAEHFHFSENQLTGPIDEKLFSEKMNLIHVIFDN

NNFTGPIPGSLGRVSSIQIIRLDHNQFSGPVPGSIANLSRLMELSLASNQLNGTVPDLTSANALTYVDLSNNNFM

SSPAPRWFSTLTSLTTLFMDSDHLTGTIPSALFSFPQLQQISLAKNSFSGELNMSSNISSLLRVVNLTNNQIFNA

EVDPSYTGSLILSGNLICFNNISFCTLKQKQQVPYSTNLGPCGAISCPTDQSANPVASQNCACASPFQGLMIFRA

PAFSDVTNPKSFQPLEFTLVQNLSLAPGSVAISNVEFSPGEPLTFTVKVFPESGTSFNHSEVIRISSSLVNQTYK

APAYFGPYSFIASTYFASPSGKRSSMGKGAIIGIAVAGFLLLVGLILVAMYALRQKKIAKEAVERTTNPFASWGQ

GGKDNGDVPQLKGARYFAFEELKRCTNNFSETQEIGSGGYGKVYKGMLANGQMAAIKRAQQGSMQGAAEFKNEIE

LLSRVHHKNLVSLVGFCYEQGEQMLVYEYIPNGTLRENLKGKGGMHLDWKKRLQIAVGSAKGLAYLHELADPPII

HRDIKSTNILLDESLNAKVADFGLSKLVSDTKKGHVSTQVKGTLGYLDPEYYMTQQLSEKSDVYSFGVVMLELIT

SRQPIEKGTYIVREIRTAIDQYDQEYYGLKSLIDPTIRDSAKMVGFRRFVQLAMECVEESAADRPTMNDVVKELE

IIIQNEGAQLLNSASLSAQQFGYAKGRDPDPYGDHVPINDDSSSSAFDYNSVYSYSVVEPK

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	89	113	0.23
LRR [Pfam ls]	138	161	1.5
LRR [Pfam ls]	162	186	0.7
LRR [Pfam ls]	241	264	0.51
LRR [Pfam ls]	288	312	0.32
Ser/Thr pkinase [Pfam fs]	629	829	2.8e-48
Ser/Thr pkinase [Pfam ls]	629	901	9.2e-46

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	65	88	3.4
LRR [sensitive, ls]	65	88	67
LRR [sensitive, ls]	89	113	0.012
LRR [sensitive, ls]	89	113	0.23
LRR [sensitive, ls]	114	137	0.92
LRR [sensitive, ls]	114	137	18
LRR [sensitive, ls]	138	161	0.078
LRR [sensitive, ls]	138	161	1.5
LRR [sensitive, ls]	162	186	0.035
LRR [sensitive, ls]	162	186	0.7
LRR [sensitive, ls]	192	212	6.6
LRR [sensitive, ls]	192	212	130
LRR [sensitive, ls]	217	240	0.51
LRR [sensitive, ls]	217	240	10
LRR [sensitive, ls]	241	264	0.026
LRR [sensitive, ls]	241	264	0.51
LRR [sensitive, ls]	265	287	2.3
LRR [sensitive, ls]	265	287	46
LRR [sensitive, ls]	288	312	0.016
LRR [sensitive, ls]	288	312	0.32
LRR [sensitive, ls]	313	336	0.86
LRR [sensitive, ls]	313	336	17
LRR [sensitive, ls]	361	386	2.4
LRR [sensitive, ls]	361	386	48

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	1	398	2e-33
FLS2 [A.thaliana]	7	398	6e-36
Xa21 [O. sativa]	8	712	5e-41
Cf-9 [L. pimpinellifolium]	45	403	2e-31
FLS2 [A.thaliana]	57	405	1e-30
Xa21 [O. sativa]	57	352	2e-28
Cf-9 [L. pimpinellifolium]	63	326	2e-17
FLS2 [A.thaliana]	64	352	2e-31
FLS2 [A.thaliana]	65	899	1e-74
Cf-9 [L. pimpinellifolium]	68	370	5e-22
CLV2 [A. thaliana]	69	352	9e-29
CLV2 [A. thaliana]	69	282	3e-15
FLS2 [A.thaliana]	69	388	1e-32
Cf-9 [L. pimpinellifolium]	71	329	2e-17
CLV2 [A. thaliana]	71	397	8e-22
Xa21 [O. sativa]	76	407	5e-26
Rpg1 [Hordeum vulgare]	615	902	1e-42
Pto [L. esculentum]	617	904	6e-62
Rpg1 [Hordeum vulgare]	622	902	3e-33

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	556	578	out -> in

Report for 2842.m00110

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)