Report for 2848.m00143

 > 2848.m00143, length: 1121, copies: 1 

MDSLWAAIAALFVAAAVVVRGAAAADDAQLLEEFRQAVPNQAALKGWSGGDGACRFPGAGCRNGRLTSLSLAGVP

LNAEFRAVAATLLQLGSVEVLSLRGANVSGALSAAGGARCGSKLQALDLSGNAALRGSVADVAALASACGGLKTL

NLSGDAVGAAKVGGGGGPGFAGLDSLDLSNNKITDDSDLRWMVDAGVGAVRWLDLALNRISGVPEFTNCSGLQYL

DLSGNLIVGEVPGGALSDCRGLKVLNLSFNHLAGVFPPDIAGLTSLNALNLSNNNFSGELPGEAFAKLQQLTALS

LSFNHFNGSIPDTVASLPELQQLDLSSNTFSGTIPSSLCQDPNSKLHLLYLQNNYLTGGIPDAVSNCTSLVSLDL

SLNYINGSIPASLGDLGNLQDLILWQNELEGEIPASLSRIQGLEHLILDYNGLTGSIPPELAKCTKLNWISLASN

RLSGPIPSWLGKLSYLAILKLSNNSFSGPIPPELGDCQSLVWLDLNSNQLNGSIPKELAKQSGKMNVGLIVGRPY

VYLRNDELSSECRGKGSLLEFTSIRPDDLSRMPSKKLCNFTRMYVGSTEYTFNKNGSMIFLDLSYNQLDSAIPGE

LGDMFYLMIMNLGHNLLSGTIPSRLAEAKKLAVLDLSYNQLEGPIPNSFSALSLSEINLSNNQLNGTIPELGSLA

TFPKSQYENNTGLCGFPLPPCDHSSPRSSNDHQSHRRQASMASSIAMGLLFSLFCIIVIIIAIGSKRRRLKNEEA

STSRDIYIDSRSHSATMNSDWRQNLSGTNLLSINLAAFEKPLQNLTLADLVEATNGFHIACQIGSGGFGDVYKAQ

LKDGKVVAIKKLIHVSGQGDREFTAEMETIGKIKHRNLVPLLGYCKAGEERLLVYDYMKFGSLEDVLHDRKKIGK

KLNWEARRKIAVGAARGLAFLHHNCIPHIIHRDMKSSNVLIDEQLEARVSDFGMARLMSVVDTHLSVSTLAGTPG

YVPPEYYQSFRCTTKGDVYSYGVVLLELLTGKPPTDSADFGEDNNLVGWVKQHTKLKITDVFDPELLKEDPSVEL

ELLEHLKIACACLDDRPSRRPTMLKVMAMFKEIQAGSTVDSKTSSAAAGSIDEGGYGVLDMPLREAKEEKD

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	199	220	7.7
LRR [Pfam ls]	221	245	0.0086
LRR [Pfam ls]	246	269	0.052
LRR [Pfam ls]	270	294	0.0021
LRR [Pfam ls]	295	318	1.6
LRR [Pfam ls]	319	343	0.12
LRR [Pfam ls]	345	368	0.034
LRR [Pfam ls]	369	392	3.2
LRR [Pfam ls]	393	413	10
LRR [Pfam ls]	417	440	0.028
LRR [Pfam ls]	441	464	1.5
LRR [Pfam ls]	489	512	1.8
LRR [Pfam ls]	630	650	1.7
LRR [Pfam ls]	653	675	0.091
Ser/Thr pkinase [Pfam fs]	807	1078	8.7e-54
Ser/Thr pkinase [Pfam ls]	807	1080	7.5e-54

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	118	141	0.53
LRR [sensitive, ls]	118	141	10
LRR [sensitive, ls]	172	193	0.73
LRR [sensitive, ls]	172	193	14
LRR [sensitive, ls]	199	220	0.39
LRR [sensitive, ls]	199	220	7.7
LRR [sensitive, ls]	221	245	0.00044
LRR [sensitive, ls]	221	245	0.0086
LRR [sensitive, ls]	246	269	0.0026
LRR [sensitive, ls]	246	269	0.052
LRR [sensitive, ls]	270	294	0.0001
LRR [sensitive, ls]	270	294	0.0021
LRR [sensitive, ls]	295	318	0.081
LRR [sensitive, ls]	295	318	1.6
LRR [sensitive, ls]	319	343	0.0062
LRR [sensitive, ls]	319	343	0.12
LRR [sensitive, ls]	345	368	0.0017
LRR [sensitive, ls]	345	368	0.034
LRR [sensitive, ls]	369	392	0.16
LRR [sensitive, ls]	369	392	3.2
LRR [sensitive, ls]	393	413	0.51
LRR [sensitive, ls]	393	413	10
LRR [sensitive, ls]	417	440	0.0014
LRR [sensitive, ls]	417	440	0.028
LRR [sensitive, ls]	441	464	0.076
LRR [sensitive, ls]	441	464	1.5
LRR [sensitive, ls]	465	488	0.6
LRR [sensitive, ls]	465	488	12
LRR [sensitive, ls]	489	512	0.09
LRR [sensitive, ls]	489	512	1.8
LRR [sensitive, ls]	582	605	0.99
LRR [sensitive, ls]	582	605	20
LRR [sensitive, ls]	606	629	3.6
LRR [sensitive, ls]	606	629	72
LRR [sensitive, ls]	630	650	0.088
LRR [sensitive, ls]	630	650	1.7
LRR [sensitive, ls]	653	675	0.0046
LRR [sensitive, ls]	653	675	0.091

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	26	706	2e-52
Cf-9 [L. pimpinellifolium]	66	311	3e-12
FLS2 [A.thaliana]	171	1084	1e-108
FLS2 [A.thaliana]	198	673	4e-54
Cf-9 [L. pimpinellifolium]	203	697	4e-40
Cf-9 [L. pimpinellifolium]	203	457	1e-24
Xa21 [O. sativa]	203	893	5e-63
Xa21 [O. sativa]	217	481	2e-39
Cf-9 [L. pimpinellifolium]	218	738	9e-53
Xa21 [O. sativa]	240	685	3e-44
Cf-9 [L. pimpinellifolium]	250	669	3e-32
CLV2 [A. thaliana]	306	669	5e-27
Xa21 [O. sativa]	322	693	3e-35
Xa21 [O. sativa]	370	686	3e-27
FLS2 [A.thaliana]	392	692	8e-23
Pto [L. esculentum]	778	1076	9e-45
Rpg1 [Hordeum vulgare]	790	1083	1e-27
Rpg1 [Hordeum vulgare]	800	1077	6e-35

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	5	24	in -> out
putative TM domain	717	739	out -> in

Report for 2848.m00143

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)