Report for 2872.m00058

 > 2872.m00058, length: 1117, copies: 1 

MPPGLSRRRRPDAAALLCCVVAVVAACMVGGALAADAQGAALLAWKRTLRGGDTALPDWNPADASPCRWTGVRCN

ANGRVTELSLQQVDLLGGVPDNLSAAMGTTLERLVLAGANLSGPIPAQLGDLPALTHLDLSNNALTGSIPASLCR

PGSKLESLYVNSNHLEGAIPDAIGNLTALRELIIFDNQLDGAIPASIGQMASLEVLRGGGNKNLQGALPPEIGNC

SKLTMLGLAETSISGPLPATLGQLKNLNTLAIYTALLSGPIPPELGRCTSLENIYLYENALSGSIPAQLGGLANL

KNLLLWQNNLVGVIPPELGACTGLAVVDLSMNGLTGHIPASLGNLSSLQELQLSVNKVSGPIPAELSRCTNLTDL

ELDNNQISGAIPAELGKLTALRMLYLWANQLTGTIPPEIGGCAGLESLDLSQNALTGPIPRSLFRLPRLSKLLLI

DNTLSGEIPPEIGNCTSLVRFRASGNHLAGDIPPEVGKLGSLSFLDLSTNRLSGAIPPEIAGCRNLTFVDLHGNA

IAGVLPPGLFQGTPSLQYLDLSYNAIGGAIPANIGMLGSLTKLVLGGNRLSGQIPPEIGSCSRLQLLDLSGNSLT

GAIPASIGKIPGLEIALNLSCNGLSGAIPKGFAGLARLGVLDVSHNQLTGDLQPLSALQNLVALNISYNNFTGRA

PETAFFARLPASDVEGNPGLCLSRCPGDASDRERAARRAARVATAVLLSALVALLAAAAFVLFGRRRQPLFGRGS

TSPADGDGKDADMLPPWDVTLYQKLEISVGDVARSLTPANVIGQGWSGAVYRASIPSTGVAIAVKKFRSSDEASV

DAFACEVGVLPRVRHRNIVRLLGWAANRRTRLLFYDYLPNGTLGGLLHGGGAAIGAAVVEWEVRLSIAVGVAEGL

AYLHHDSVPAILHRDVKSDNILLGERYEACLADFGLARVADDGANSSPPPFAGSYGYIAPEYGCMTKITTKSDVY

SFGVVLLEIITGRRPIEAAFGEGQTVVQWVREHLHRKRDPAEVIDSRLQGRSDTQVQEMLQALGIALLCASTRPE

DRPTMKDVAALLRGLRHDDSAEAQKAGSGSAIKWADPRQPGSPTKPMAQAQAHSHTSSLAYSTTGSV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	129	153	0.069
LRR [Pfam ls]	154	177	0.029
LRR [Pfam ls]	275	298	0.36
LRR [Pfam ls]	299	322	4
LRR [Pfam ls]	323	346	9.3
LRR [Pfam ls]	347	370	7.2
LRR [Pfam ls]	371	394	0.011
LRR [Pfam ls]	395	418	4.8
LRR [Pfam ls]	419	442	0.025
LRR [Pfam ls]	443	466	10
LRR [Pfam ls]	491	514	0.34
LRR [Pfam ls]	515	539	0.024
LRR [Pfam ls]	540	563	0.53
LRR [Pfam ls]	564	587	0.28
LRR [Pfam ls]	588	611	0.027
LRR [Pfam ls]	637	659	0.29
LRR [Pfam ls]	660	685	8.2
Ser/Thr pkinase [Pfam fs]	786	990	5.1e-44
Ser/Thr pkinase [Pfam ls]	786	1062	8.5e-42

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	105	128	0.84
LRR [sensitive, ls]	105	128	17
LRR [sensitive, ls]	129	153	0.0035
LRR [sensitive, ls]	129	153	0.069
LRR [sensitive, ls]	154	177	0.0015
LRR [sensitive, ls]	154	177	0.029
LRR [sensitive, ls]	178	201	1.4
LRR [sensitive, ls]	178	201	28
LRR [sensitive, ls]	227	250	1.5
LRR [sensitive, ls]	227	250	30
LRR [sensitive, ls]	275	298	0.018
LRR [sensitive, ls]	275	298	0.36
LRR [sensitive, ls]	299	322	0.2
LRR [sensitive, ls]	299	322	4
LRR [sensitive, ls]	323	346	0.47
LRR [sensitive, ls]	323	346	9.3
LRR [sensitive, ls]	347	370	0.37
LRR [sensitive, ls]	347	370	7.2
LRR [sensitive, ls]	371	394	0.00057
LRR [sensitive, ls]	371	394	0.011
LRR [sensitive, ls]	395	418	0.24
LRR [sensitive, ls]	395	418	4.8
LRR [sensitive, ls]	419	442	0.0013
LRR [sensitive, ls]	419	442	0.025
LRR [sensitive, ls]	443	466	0.51
LRR [sensitive, ls]	443	466	10
LRR [sensitive, ls]	467	490	0.79
LRR [sensitive, ls]	467	490	16
LRR [sensitive, ls]	491	514	0.017
LRR [sensitive, ls]	491	514	0.34
LRR [sensitive, ls]	515	539	0.0012
LRR [sensitive, ls]	515	539	0.024
LRR [sensitive, ls]	540	563	0.027
LRR [sensitive, ls]	540	563	0.53
LRR [sensitive, ls]	564	587	0.014
LRR [sensitive, ls]	564	587	0.28
LRR [sensitive, ls]	588	611	0.0013
LRR [sensitive, ls]	588	611	0.027
LRR [sensitive, ls]	612	636	8.1
LRR [sensitive, ls]	612	636	160
LRR [sensitive, ls]	637	659	0.015
LRR [sensitive, ls]	637	659	0.29
LRR [sensitive, ls]	660	685	0.42
LRR [sensitive, ls]	660	685	8.2

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	30	873	1e-83
FLS2 [A.thaliana]	56	680	1e-100
Cf-9 [L. pimpinellifolium]	59	661	1e-53
Cf-9 [L. pimpinellifolium]	77	483	9e-42
Cf-9 [L. pimpinellifolium]	79	695	4e-55
FLS2 [A.thaliana]	79	536	4e-66
CLV2 [A. thaliana]	82	541	6e-46
FLS2 [A.thaliana]	89	1066	1e-145
CLV2 [A. thaliana]	133	706	5e-66
FLS2 [A.thaliana]	167	684	3e-79
CLV2 [A. thaliana]	322	677	6e-43
Cf-9 [L. pimpinellifolium]	466	692	1e-12
Rpg1 [Hordeum vulgare]	737	1058	6e-17
Rpg1 [Hordeum vulgare]	790	1058	5e-26
Pto [L. esculentum]	792	1058	2e-36

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	13	35	in -> out
putative TM domain	717	739	out -> in
putative TM domain	862	884	in -> out

Report for 2872.m00058

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)