Report for 2872.m00066

 > 2872.m00066, length: 628, copies: 1 

MRMRWWAAPLAAVLAVILLPSSTATLSPAGINYEVVALMAIKTELQDPYNVLDNWDINSVDPCSWRMVTCSADGY

VSALGLPSQSLSGKLSPGIGNLTRLQSVLLQNNAISGTIPASIGRLGMLQTLDMSDNQITGSIPSSIGDLKNLNY

LKLNNNSLSGVLPDSLAAINGLALVDLSFNNLSGPLPKISSRTFNIVGNPMICGVKSGDNCSSVSMDPLSYPPDD

LKTQPQQGIARSHRIAIICGVTVGSVAFATIIVSMLLWWRHRRNQQIFFDVNDQYDPEVCLGHLKRYAFKELRAA

TNNFNSKNILGEGGYGIVYKGFLRDGAIVAVKRLKDYNAVGGEVQFQTEVEVISLAVHRNLLRLIGFCTTENERL

LVYPYMPNGSVASQLRELVNGKPALDWSRRKRIALGTARGLLYLHEQCDPKIIHRDVKASNVLLDEYFEAIVGDF

GLAKLLDHRESHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDWVKK

LHQEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDGLAEKWEASQNVDTPKSVSS

ELLPPKFMDFAADESSLGLEAMELSGPR

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	99	122	4
LRR [Pfam ls]	123	146	0.024
LRR [Pfam ls]	147	170	0.72
Ser/Thr pkinase [Pfam fs]	304	503	4.9e-50
Ser/Thr pkinase [Pfam ls]	304	579	1.1e-45

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	99	122	0.2
LRR [sensitive, ls]	99	122	4
LRR [sensitive, ls]	123	146	0.0012
LRR [sensitive, ls]	123	146	0.024
LRR [sensitive, ls]	147	170	0.036
LRR [sensitive, ls]	147	170	0.72
LRR [sensitive, ls]	171	193	1.6
LRR [sensitive, ls]	171	193	32

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	15	187	3e-21
FLS2 [A.thaliana]	34	188	4e-27
CLV2 [A. thaliana]	37	188	5e-13
Xa21 [O. sativa]	65	187	3e-13
CLV2 [A. thaliana]	75	187	1e-11
CLV2 [A. thaliana]	76	196	6e-15
CLV2 [A. thaliana]	76	227	9e-11
FLS2 [A.thaliana]	76	187	1e-12
FLS2 [A.thaliana]	76	192	3e-12
FLS2 [A.thaliana]	76	196	1e-11
FLS2 [A.thaliana]	76	187	1e-10
Xa21 [O. sativa]	76	196	5e-12
CLV2 [A. thaliana]	78	187	6e-12
Xa21 [O. sativa]	78	187	4e-14
Cf-9 [L. pimpinellifolium]	79	188	1e-10
CLV2 [A. thaliana]	79	187	4e-15
FLS2 [A.thaliana]	79	593	5e-57
FLS2 [A.thaliana]	79	186	9e-16
FLS2 [A.thaliana]	79	187	8e-15
FLS2 [A.thaliana]	79	243	8e-15
FLS2 [A.thaliana]	79	187	1e-14
Xa21 [O. sativa]	79	395	7e-28
Xa21 [O. sativa]	79	187	8e-19
Xa21 [O. sativa]	79	214	3e-14
FLS2 [A.thaliana]	85	214	2e-11
FLS2 [A.thaliana]	87	188	2e-11
Rpg1 [Hordeum vulgare]	290	601	3e-38
Pto [L. esculentum]	291	578	5e-51
Rpg1 [Hordeum vulgare]	291	584	9e-26

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	10	32	out -> in
putative TM domain	242	264	in -> out

Report for 2872.m00066

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)