Report for 2900.m00134

 > 2900.m00134, length: 972, copies: 2 

MARMARTPVHPRSSSIVAAFTYLLLVLFRDAITTAAASPKAPASTNGCIAAERDALLSFKAGITRDPKKRLSSWL

GENCCQWSGVRCSNRTGHVIILNLSNTYLYYDDPHYYKCAHVDFPLYGYISSSLVSLRQLKRLDLSGNVLGESMP

EFLGSFQSLTHLNLARMGFYGRVPHQLGNLSNLQFLDITSEIYDHPPMHTADISWLARLPSLKYLDMSYVNLSSV

VDWVRPVNMLSRLEVLRLTGCWIMSSSSTGLTNLTSLETLDLSENTLFGTVIPNWVWSMKTVKMLNLASCQLSGS

FPDGLGNLTLLEGLNLGGDSYHGSNSFEGTLPSTLNNTCNLRVLYLNENLIGVEIKDLMDKLPSCTWNKLEELDL

SYNDITGNLDWLGSQTSLTSLYLSWNKFSGHLPLLIREMANLTTLILHNNNISGVISNQHLSGLESLERIIMSYN

PLKVVLDESWSPPFGLFDVYFASCQLGPEFPVWIKSLNNCYSIDVSSSGIKDELPNWFWNLVSDVANVNISHNQI

RGKLPDSFQGMSTEKLILASNQLTGRLPSLQENLYYLDISRNLLSGPLPFHFGGANLGKLILFSNHINGSIPQSL

CKMHNLGALDLADNFLVGELPHCLPTELKPSTGGSFIHSTSLNIHILLLSKNQLSGEFPMLLQSCQSITILDLAW

NKYSGKLPEWIGGFTKLDHLRYLDIANNSFSGTIPQSLPCLKGMINEPENLETWFLFGEALENGFGAFDVFGLFH

YSISCVLQGQQLEYSKGLVYLVGLDFSSNKLSGHIPKEIGSLVELVNLNLSWNQLAGNIPDQIGELHQLTSLDLS

YNQFSGEIPSSLSNLTFLSYLNLSYNNLSGRIPRGHQLDTLNADDPSLMYIGNPGLCGYPLAKNCPENGTSQGQT

VKSHHDGSFCAGLSVGFVIGVWMVLASLLFKKSWRFSYFHHFDRQYDRLNVFLTVTSAIYLQKATRFKDGRS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	134	157	0.44
LRR [Pfam ls]	237	260	7.6
LRR [Pfam ls]	261	285	0.65
LRR [Pfam ls]	286	309	1.8
LRR [Pfam ls]	340	363	7.1
LRR [Pfam ls]	369	391	0.48
LRR [Pfam ls]	392	415	2.7
LRR [Pfam ls]	416	440	0.083
LRR [Pfam ls]	514	537	4.7
LRR [Pfam ls]	694	717	0.029
LRR [Pfam ls]	770	793	6.6
LRR [Pfam ls]	794	817	7.6
LRR [Pfam fs]	818	841	6.2e-05
LRR [Pfam ls]	818	841	0.001
LRR [Pfam ls]	842	864	3.4

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	134	157	0.022
LRR [sensitive, ls]	134	157	0.44
LRR [sensitive, ls]	158	181	1.4
LRR [sensitive, ls]	158	181	28
LRR [sensitive, ls]	211	233	4.3
LRR [sensitive, ls]	211	233	85
LRR [sensitive, ls]	237	260	0.39
LRR [sensitive, ls]	237	260	7.6
LRR [sensitive, ls]	261	285	0.033
LRR [sensitive, ls]	261	285	0.65
LRR [sensitive, ls]	286	309	0.092
LRR [sensitive, ls]	286	309	1.8
LRR [sensitive, ls]	340	363	0.36
LRR [sensitive, ls]	340	363	7.1
LRR [sensitive, ls]	369	391	0.025
LRR [sensitive, ls]	369	391	0.48
LRR [sensitive, ls]	392	415	0.14
LRR [sensitive, ls]	392	415	2.7
LRR [sensitive, ls]	416	440	0.0042
LRR [sensitive, ls]	416	440	0.083
LRR [sensitive, ls]	441	464	2.2
LRR [sensitive, ls]	441	464	43
LRR [sensitive, ls]	489	512	1.7
LRR [sensitive, ls]	489	512	33
LRR [sensitive, ls]	514	537	0.24
LRR [sensitive, ls]	514	537	4.7
LRR [sensitive, ls]	558	578	0.88
LRR [sensitive, ls]	558	578	17
LRR [sensitive, ls]	581	604	0.67
LRR [sensitive, ls]	581	604	13
LRR [sensitive, ls]	605	629	0.54
LRR [sensitive, ls]	605	629	11
LRR [sensitive, ls]	643	666	0.83
LRR [sensitive, ls]	643	666	16
LRR [sensitive, ls]	667	690	5
LRR [sensitive, ls]	667	690	98
LRR [sensitive, ls]	694	717	0.0015
LRR [sensitive, ls]	694	717	0.029
LRR [sensitive, ls]	770	793	0.34
LRR [sensitive, ls]	770	793	6.6
LRR [sensitive, ls]	794	817	0.38
LRR [sensitive, ls]	794	817	7.6
LRR [sensitive, ls]	818	841	5.3e-05
LRR [sensitive, ls]	818	841	0.001
LRR [sensitive, ls]	842	864	0.17
LRR [sensitive, ls]	842	864	3.4

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	52	711	2e-42
FLS2 [A.thaliana]	52	883	2e-73
Cf-9 [L. pimpinellifolium]	70	890	3e-75
Xa21 [O. sativa]	121	555	7e-22
CLV2 [A. thaliana]	233	927	4e-49
Xa21 [O. sativa]	265	883	1e-40
Xa21 [O. sativa]	365	858	6e-37
FLS2 [A.thaliana]	700	858	6e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	908	930	out -> in

Report for 2900.m00134

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)