Report for 2931.m00163

 > 2931.m00163, length: 947, copies: 2 

MAAASPLARLLAALLAVAAAATAATALTDDVLALVVFKTGVADPMGRLAAWTEDDDRPCSWPGVGCDARAGRVTS

LSLPGASLSGRLPRALLRLDALASLSLPRNNLSGPVLPGLLAALPRLRSLDLSSNRLAAPVPAELFAQCRSIRAL

SLARNELSGYIPPAVTSCASLVSLNLSSNRLAGPIPDGLWSLPSLRSLDLSGNELSGSVPGGFPGSSSLRAVDLS

RNLLAGEIPADVGEAALLKSLDVGHNLFTGGLPESLRRLSALRFLGVGGNALAGEVPSWIGEMWALERLDLSGNR

FSGAIPDAIAKCKKMVEADLSRNALAGELPWWVFGLPLQRVSVAGNKLYGWVKVPADAALALRALDLSSNGFSGG

IPPQITAFAGLQYLNMSSNSFARQLPAGIGGMRLLEVLDVSANRLDGGVPPEIGGAVALRELRLGRNSFTGHIPS

QIGNCSSLVALDLSHNNLTGSIPSTVGNLTSLEVVDLSKNKLNGTLPVELSNLPSLRIFDVSHNLLSGDLPNSRF

FDNIPETFLSDNQGLCSSRKNNSCIAIMPKPIVLNPNSSTNPLSQATPTAPSSMHHKKIILSVSTLIAIAGGGTI

IIGVIIISVLNRRARATTSRSAPATALSDDYLSQSPENDASSGKLVMFGKGSPEFSAGGHALLNKDCELGRGGFG

AVYKTVLRDGQPVAIKKLTVSSLVKSKDDFERQVKLLSKVRHHNVVALRGFYWTSSLQLLIYDYLPGGNLHKHLH

ECTEDNSLSWMERFDIILGVARGLTHLHQRGIIHYNLKSSNVLLDSNGEPRVGDYGLAKLLPMLDRYVLSSKIQS

ALGYMAPEFACKTVKITEKCDVYGFGVLVLEVLTGRRPVEYLEDDVVVLCDLVRSALEEGRLEDCMDPRLCGEFP

MEEALPIIKLGLVCTSRVPSNRPDMGEVVNILELVRSPQDSLEDELV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	121	145	0.32
LRR [Pfam ls]	170	193	0.076
LRR [Pfam ls]	194	217	0.008
LRR [Pfam ls]	242	265	1.7
LRR [Pfam ls]	290	313	0.021
LRR [Pfam ls]	361	384	2.1
LRR [Pfam ls]	385	408	8
LRR [Pfam ls]	433	456	0.92
LRR [Pfam ls]	457	480	0.0026
LRR [Pfam ls]	481	504	0.031
Ser/Thr pkinase [Pfam fs]	663	863	1.5e-45
Ser/Thr pkinase [Pfam ls]	663	934	8.9e-43

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	72	95	6.4
LRR [sensitive, ls]	72	95	130
LRR [sensitive, ls]	96	120	1.1
LRR [sensitive, ls]	96	120	21
LRR [sensitive, ls]	121	145	0.016
LRR [sensitive, ls]	121	145	0.32
LRR [sensitive, ls]	146	169	0.64
LRR [sensitive, ls]	146	169	13
LRR [sensitive, ls]	170	193	0.0038
LRR [sensitive, ls]	170	193	0.076
LRR [sensitive, ls]	194	217	0.00041
LRR [sensitive, ls]	194	217	0.008
LRR [sensitive, ls]	218	241	0.85
LRR [sensitive, ls]	218	241	17
LRR [sensitive, ls]	242	265	0.085
LRR [sensitive, ls]	242	265	1.7
LRR [sensitive, ls]	266	289	5.3
LRR [sensitive, ls]	266	289	100
LRR [sensitive, ls]	290	313	0.0011
LRR [sensitive, ls]	290	313	0.021
LRR [sensitive, ls]	314	337	5.2
LRR [sensitive, ls]	314	337	100
LRR [sensitive, ls]	361	384	0.11
LRR [sensitive, ls]	361	384	2.1
LRR [sensitive, ls]	385	408	0.41
LRR [sensitive, ls]	385	408	8
LRR [sensitive, ls]	409	432	0.75
LRR [sensitive, ls]	409	432	15
LRR [sensitive, ls]	433	456	0.047
LRR [sensitive, ls]	433	456	0.92
LRR [sensitive, ls]	457	480	0.00013
LRR [sensitive, ls]	457	480	0.0026
LRR [sensitive, ls]	481	504	0.0016
LRR [sensitive, ls]	481	504	0.031
LRR [sensitive, ls]	505	529	0.64
LRR [sensitive, ls]	505	529	13

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	21	521	2e-61
CLV2 [A. thaliana]	30	538	8e-60
Xa21 [O. sativa]	30	757	2e-69
Cf-9 [L. pimpinellifolium]	59	538	4e-42
Cf-9 [L. pimpinellifolium]	73	403	1e-23
Cf-9 [L. pimpinellifolium]	75	529	1e-39
CLV2 [A. thaliana]	76	549	5e-38
Cf-9 [L. pimpinellifolium]	82	540	1e-53
FLS2 [A.thaliana]	82	521	1e-61
FLS2 [A.thaliana]	83	945	4e-97
FLS2 [A.thaliana]	351	529	6e-20
Pto [L. esculentum]	669	942	2e-42
Rpg1 [Hordeum vulgare]	669	946	9e-23
Rpg1 [Hordeum vulgare]	671	935	6e-21

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	588	610	out -> in

Report for 2931.m00163

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)