Report for 2942.m00117

 > 2942.m00117, length: 1413, copies: 1 

MAPMLSIASRSPSPALIAPHASARATGLRAPFAGNRIVGWGWGDQTKSGTDRNRASICVVLFLRVRSGEPTQAPR

DPPAAVGGGGCYVRLPAPPRDRDAVLYHVCLFTLLLCFIPITALAESDIKNLFALRKAIAVGKGFLHNWFELETP

PCNWSGISCVGLTVVAIDLSSTPLYVDFPSQIIAFQSLVRLNVSGCGFSGELPEAMVNLQHLQHLDLSDNQLGGP

LPASLFDLKMLKVMVLDNNMFSGQLSPAIAHLQQLTVLSISTNSFSGGLPPELGSLKNLEYLDIHTNAFSGSIPA

SFSNLSRLLYLDANNNNLTGSIFPGIRALVNLVKLDLSSNGLVGAIPKELCQLKNLQSLILSDNELTGSIPEEIG

NLKQLEVLNLLKCNLMDTVPLSIGNLEILEGLYISFNSFSGELPASVGELRNLRQLMAKSAGFTGSIPKELGNCK

KLTTLVLSGNNFTGTIPEELADLVAVVLFDVEGNRLSGHIPDWIQNWSNVSSISLAQNMFDGPLPGLPLHLVSFS

AESNRLSGSIPAKICQGTFLQILRLNDNNLTGSIDETFKGCKNLTELSLLDNHLHGEIPEYLALLPLVSLDLSHN

NFTGMIPDRLWESSTILDISLSDNQLTGMITESIGKLLSLQSLSIDRNYLQGPLPRSIGALRNLTALSLSGNMLS

EDIPIQLFNCRNLVTLDLSCNNLTGHIPKAISHLTKLNTLVLSRNRLSGAIPSELCVAFSRESHSELEYVQHIGL

IDLSRNRLTGHIPRAINNCSILVELHLQDNLLSGTIPVELAELRNITTIDLSSNALVGPVLPWPVPLASLQGLLL

SNNRLSGSIPSGIGNILPQITMLDLSGNALTGTLPLDLLCKESLNHLDVSDNNISGQIPFSCHEDKESPIPLIFF

NASSNHFSGSLDESISNFTKLTYLDLHNNSLTGRLPSAIARVTSLYYLDLSSNDFSGTIPCGICGMFGLTFANFS

GNRDGGTFTLADCAAEEGGVCAANRVDRKMPDHPFHVLEATICCIATAIVIVLVVILVVYLRRRRKMLRRRQFVL

VPAGDNAMADHETTLSNNLLGRRRMKKREPPSINLATFEHAPVRVTVDEIMRATGNFDGMHVVGDGGFGTVYRAE

LPGGRRVAVKRLHGVGRRFQGGEREFRAEMETVGKVRHPNLVPLLGYCAAGDERFLVYEYMEHGSLEDRLRGGGG

AALGWPERLTICGGAARGLAFLHHGFVPHVIHRDVKSSNVLLGEGLQPRVSDFGLARIISACETHVSTVLAGTLG

YIPPEYALAMRCTAKGDVYSFGVVMLELLTGRPPTWSSAEVTAEGDDERGGGGSLVGWVRWMAARGRGGEVFDAC

LPVSGAEREQMARVLDVARDCTADEPWRRPTMAEVARRVGAIEAMEYGPLVVAVSSGEPPAMP

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	187	210	3.1
LRR [Pfam ls]	211	234	0.014
LRR [Pfam ls]	259	282	0.14
LRR [Pfam ls]	283	306	0.018
LRR [Pfam ls]	307	330	5.6
LRR [Pfam ls]	331	354	0.046
LRR [Pfam fs]	355	378	4.1e-05
LRR [Pfam ls]	355	378	0.00067
LRR [Pfam ls]	451	474	0.0097
LRR [Pfam ls]	544	567	0.063
LRR [Pfam ls]	591	614	4.9
LRR [Pfam ls]	639	662	1.5
LRR [Pfam ls]	663	686	0.72
LRR [Pfam fs]	687	710	2.2e-05
LRR [Pfam ls]	687	710	0.00035
LRR [Pfam ls]	711	735	1.3
LRR [Pfam ls]	747	770	2.3
LRR [Pfam ls]	771	794	3.8
LRR [Pfam ls]	819	843	0.41
LRR [Pfam ls]	844	865	2.8
LRR [Pfam ls]	868	888	2.5
LRR [Pfam ls]	920	943	0.021
LRR [Pfam ls]	944	967	0.67
Ser/Thr pkinase [Pfam fs]	1107	1311	5.8e-49
Ser/Thr pkinase [Pfam ls]	1107	1390	1.3e-45

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	187	210	0.15
LRR [sensitive, ls]	187	210	3.1
LRR [sensitive, ls]	211	234	0.00069
LRR [sensitive, ls]	211	234	0.014
LRR [sensitive, ls]	235	258	1.7
LRR [sensitive, ls]	235	258	34
LRR [sensitive, ls]	259	282	0.0068
LRR [sensitive, ls]	259	282	0.14
LRR [sensitive, ls]	283	306	0.00085
LRR [sensitive, ls]	283	306	0.018
LRR [sensitive, ls]	307	330	0.27
LRR [sensitive, ls]	307	330	5.6
LRR [sensitive, ls]	331	354	0.0022
LRR [sensitive, ls]	331	354	0.046
LRR [sensitive, ls]	355	378	3.2e-05
LRR [sensitive, ls]	355	378	0.00067
LRR [sensitive, ls]	379	402	1.8
LRR [sensitive, ls]	379	402	37
LRR [sensitive, ls]	403	426	1.4
LRR [sensitive, ls]	403	426	29
LRR [sensitive, ls]	427	450	2.3
LRR [sensitive, ls]	427	450	48
LRR [sensitive, ls]	451	474	0.00046
LRR [sensitive, ls]	451	474	0.0097
LRR [sensitive, ls]	475	498	1.2
LRR [sensitive, ls]	475	498	26
LRR [sensitive, ls]	520	543	6.1
LRR [sensitive, ls]	520	543	130
LRR [sensitive, ls]	544	567	0.003
LRR [sensitive, ls]	544	567	0.063
LRR [sensitive, ls]	568	588	1.5
LRR [sensitive, ls]	568	588	31
LRR [sensitive, ls]	591	614	0.24
LRR [sensitive, ls]	591	614	4.9
LRR [sensitive, ls]	615	638	0.56
LRR [sensitive, ls]	615	638	12
LRR [sensitive, ls]	639	662	0.072
LRR [sensitive, ls]	639	662	1.5
LRR [sensitive, ls]	663	686	0.035
LRR [sensitive, ls]	663	686	0.72
LRR [sensitive, ls]	687	710	1.7e-05
LRR [sensitive, ls]	687	710	0.00035
LRR [sensitive, ls]	711	735	0.062
LRR [sensitive, ls]	711	735	1.3
LRR [sensitive, ls]	747	770	0.11
LRR [sensitive, ls]	747	770	2.3
LRR [sensitive, ls]	771	794	0.18
LRR [sensitive, ls]	771	794	3.8
LRR [sensitive, ls]	795	818	1.8
LRR [sensitive, ls]	795	818	37
LRR [sensitive, ls]	819	843	0.02
LRR [sensitive, ls]	819	843	0.41
LRR [sensitive, ls]	844	865	0.14
LRR [sensitive, ls]	844	865	2.8
LRR [sensitive, ls]	868	888	0.12
LRR [sensitive, ls]	868	888	2.5
LRR [sensitive, ls]	920	943	0.001
LRR [sensitive, ls]	920	943	0.021
LRR [sensitive, ls]	944	967	0.032
LRR [sensitive, ls]	944	967	0.67

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	106	1385	1e-149
Xa21 [O. sativa]	134	607	6e-54
CLV2 [A. thaliana]	164	492	2e-29
Cf-9 [L. pimpinellifolium]	174	731	2e-53
N [N. glutinosa]	176	312	3e-11
CLV2 [A. thaliana]	186	635	1e-45
CLV2 [A. thaliana]	187	675	4e-55
Xa21 [O. sativa]	187	444	9e-39
Xa21 [O. sativa]	188	728	5e-68
Cf-9 [L. pimpinellifolium]	215	837	5e-58
CLV2 [A. thaliana]	239	859	2e-61
Cf-9 [L. pimpinellifolium]	287	977	2e-64
CLV2 [A. thaliana]	332	959	3e-55
Xa21 [O. sativa]	332	884	4e-67
CLV2 [A. thaliana]	383	999	2e-58
Xa21 [O. sativa]	430	1195	4e-67
CLV2 [A. thaliana]	472	978	4e-45
Cf-9 [L. pimpinellifolium]	476	978	1e-39
Cf-9 [L. pimpinellifolium]	568	983	4e-35
Cf-9 [L. pimpinellifolium]	572	991	3e-33
CLV2 [A. thaliana]	592	986	1e-32
CLV2 [A. thaliana]	598	981	2e-33
Cf-9 [L. pimpinellifolium]	632	981	2e-19
Rpg1 [Hordeum vulgare]	1008	1400	2e-32
Pto [L. esculentum]	1082	1365	2e-45
Rpg1 [Hordeum vulgare]	1104	1400	6e-32

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	99	121	in -> out
putative TM domain	1013	1035	out -> in

Report for 2942.m00117

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)