Report for 2962.m00101

 > 2962.m00101, length: 481, copies: 1 

MSCSFPWGSFCFFLVVLCLPDSNISTSSHGCFVEERTALMDIGSSLTRSNGTAPRSWGRGDDCCLWERVNCSNIT

GRVSHLYFSNLYDSNEVLDAHGHSFWRFDTTVFSSFPELQFLDLSMNNATFQSWDVFESLRNLRELDLSSNRLNG

SIPSLFSLPRLEHLSLSQNLFEGSIPVTPSSNITSALKTFNFSMNNLSGEFSFFWLRNLTKLQKIDVSGNANLVV

AVNFPSWSPSFQLKVLVLSGCNLDKNIVREPIFLRTQHQLEVLDLSNNSLSGSMPNWLFTEQATLVYLNLGNNSL

TGSLGPIWYPQMNLQAISLPMNRISGHLPANISSVFPNMSFLDVSSNTISGEIPSSLCNITRMEYLDLSNNSLSG

ELPNCLLTEYPILTTLKVSNNKLGGPIFGGTNHLSIKHALYLDGNKFEGTLPRYLTADFDAHGTLDLHDNNLSVP

FSFFNSSTVMALDLSHNQFNGNIEWVQYLGE

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	137	159	0.0031
LRR [Pfam ls]	160	184	4
LRR [Pfam ls]	264	288	0.12
LRR [Pfam ls]	289	311	4.2
LRR [Pfam ls]	338	361	2.8
LRR [Pfam ls]	362	386	0.11

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	137	159	0.00015
LRR [sensitive, ls]	137	159	0.0031
LRR [sensitive, ls]	160	184	0.2
LRR [sensitive, ls]	160	184	4
LRR [sensitive, ls]	186	210	4.1
LRR [sensitive, ls]	186	210	82
LRR [sensitive, ls]	211	233	1.5
LRR [sensitive, ls]	211	233	29
LRR [sensitive, ls]	237	260	3
LRR [sensitive, ls]	237	260	60
LRR [sensitive, ls]	264	288	0.0059
LRR [sensitive, ls]	264	288	0.12
LRR [sensitive, ls]	289	311	0.21
LRR [sensitive, ls]	289	311	4.2
LRR [sensitive, ls]	313	337	2
LRR [sensitive, ls]	313	337	41
LRR [sensitive, ls]	338	361	0.14
LRR [sensitive, ls]	338	361	2.8
LRR [sensitive, ls]	362	386	0.0054
LRR [sensitive, ls]	362	386	0.11
LRR [sensitive, ls]	387	410	2.1
LRR [sensitive, ls]	387	410	43
LRR [sensitive, ls]	458	480	5.8
LRR [sensitive, ls]	458	480	120

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	4	473	6e-24
Cf-9 [L. pimpinellifolium]	14	378	2e-12
CLV2 [A. thaliana]	36	473	9e-32
Cf-9 [L. pimpinellifolium]	56	473	6e-28
FLS2 [A.thaliana]	68	402	2e-21
Cf-9 [L. pimpinellifolium]	72	447	3e-18
Cf-9 [L. pimpinellifolium]	77	473	7e-29
CLV2 [A. thaliana]	88	383	1e-10
Xa21 [O. sativa]	108	473	3e-26
CLV2 [A. thaliana]	110	426	4e-22
Cf-9 [L. pimpinellifolium]	114	424	5e-21
FLS2 [A.thaliana]	114	473	4e-22
FLS2 [A.thaliana]	114	473	6e-22
FLS2 [A.thaliana]	134	473	9e-29
FLS2 [A.thaliana]	138	473	6e-22

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 2962.m00101

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)