Report for 2971.m00137

 > 2971.m00137, length: 1123, copies: 2 

MASRSPAAAAAAMVMACVVVVLRVSCVLAVDEQGAALLAWKATLRGDGGALADWKAGDASPCRWTGVTCNADGGV

TELSLEFVDLFGGVPGNLAAAVGRTLTRLVLTGANLTGPIPPELGELPALAHLDLSNNALTGTIPAALCRPGSKL

ETLYLNSNRLEGAIPDTIGNLTSLRELIVYDNQLAGKIPASIGKMSSLEVLRGGGNKNLQGALPAEIGDCSSLTM

IGLAETSITGPLPASLGRLKNLTTLAIYTALLSGPIPPELGRCGCLENIYLYENALSGSIPAQLGGLGKLRNLLL

WQNQLVGVIPPELGSCAALAVVDLSLNGLTGHIPPSFGNLSSLQELQLSVNKLSGAVPPELARCSNLTDLELDNN

QLTGGIPAELGRLPALRMLYLWANQLTGSIPPELGRCGSLEALDLSSNALTGAIPRSLFRLPRLSKLLLINNNLS

GELPPEIGSCAALVRFRASGNHIAGAIPPEIGMLGNLSFLDLASNRLAGALPPEMSGCRNLTFVDLHDNAISGEL

PPRLFRDWLSLQYLDLSDNVIAGGIPPEIGMLTSLTKLVLGGNRLSGPMPPEIGSCTRLQLLDVGGNSLSGHVPG

SIGKIPGLEIALNLSCNGFSGAIPAEFAGLVRLGVLDVSRNQLSGDLQPLSALQNLVALNVSFNGFTGRLPETAF

FARLPTSDVEGNPALCLSRCSGDASEREVEARRAARVAMAVLLSALVVLLAAAALVLFGWHRRGGGARGGEDKDG

EMSPPWDVTLYQKLEIGVSDVARSLTPANVIGHGWSGEVYRASMPSSGVTIAVKKFRSCDEASIEAFAGEVSVLP

RVRHRNIVRLLGWAANRRTRLLFYDYLPNGTLGGLLHGGAMGGGATTTAAVVEWEVRLAIAVGVAEGLTYLHHDC

VPGIIHRDVKADNILLADRYEACLADFGLARVADDGASSSPPPFAGSYGYIAPEYGCMTKITTKSDVYSFGVVLL

EMITGRRPLDPAFGEGQSVVQWVRDHLCRKRDPAEIIDVRLQGRPDTQVQEMLQALGMALLCASPRPEDRPTMKD

VAALLRGIRHDDGVEARKAGNGVGTDAETRKRADPRQPISPTKLMALARPAQAQAQLQARANSGSLGLLNDQE

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	100	123	3.5
LRR [Pfam ls]	124	147	0.28
LRR [Pfam ls]	149	172	0.0072
LRR [Pfam ls]	173	196	0.64
LRR [Pfam ls]	270	293	0.45
LRR [Pfam ls]	318	341	0.52
LRR [Pfam ls]	342	365	0.96
LRR [Pfam ls]	366	389	0.0035
LRR [Pfam ls]	390	413	5
LRR [Pfam ls]	414	437	0.053
LRR [Pfam ls]	486	509	3.1
LRR [Pfam ls]	510	534	0.019
LRR [Pfam ls]	535	558	0.017
LRR [Pfam ls]	559	582	4.3
LRR [Pfam ls]	583	606	1.7
LRR [Pfam ls]	632	654	1.1
LRR [Pfam ls]	655	679	6.8
Ser/Thr pkinase [Pfam fs]	775	985	1.5e-43
Ser/Thr pkinase [Pfam ls]	775	1055	5.3e-40

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	100	123	0.13
LRR [sensitive, ls]	100	123	3.5
LRR [sensitive, ls]	124	147	0.01
LRR [sensitive, ls]	124	147	0.28
LRR [sensitive, ls]	149	172	0.00026
LRR [sensitive, ls]	149	172	0.0072
LRR [sensitive, ls]	173	196	0.024
LRR [sensitive, ls]	173	196	0.64
LRR [sensitive, ls]	222	245	1.1
LRR [sensitive, ls]	222	245	29
LRR [sensitive, ls]	270	293	0.017
LRR [sensitive, ls]	270	293	0.45
LRR [sensitive, ls]	294	317	0.3
LRR [sensitive, ls]	294	317	8
LRR [sensitive, ls]	318	341	0.019
LRR [sensitive, ls]	318	341	0.52
LRR [sensitive, ls]	342	365	0.035
LRR [sensitive, ls]	342	365	0.96
LRR [sensitive, ls]	366	389	0.00013
LRR [sensitive, ls]	366	389	0.0035
LRR [sensitive, ls]	390	413	0.18
LRR [sensitive, ls]	390	413	5
LRR [sensitive, ls]	414	437	0.0019
LRR [sensitive, ls]	414	437	0.053
LRR [sensitive, ls]	438	461	0.36
LRR [sensitive, ls]	438	461	9.7
LRR [sensitive, ls]	462	485	2.8
LRR [sensitive, ls]	462	485	76
LRR [sensitive, ls]	486	509	0.12
LRR [sensitive, ls]	486	509	3.1
LRR [sensitive, ls]	510	534	0.00072
LRR [sensitive, ls]	510	534	0.019
LRR [sensitive, ls]	535	558	0.00062
LRR [sensitive, ls]	535	558	0.017
LRR [sensitive, ls]	559	582	0.16
LRR [sensitive, ls]	559	582	4.3
LRR [sensitive, ls]	583	606	0.064
LRR [sensitive, ls]	583	606	1.7
LRR [sensitive, ls]	632	654	0.042
LRR [sensitive, ls]	632	654	1.1
LRR [sensitive, ls]	655	679	0.25
LRR [sensitive, ls]	655	679	6.8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	35	704	2e-66
FLS2 [A.thaliana]	36	675	5e-99
Xa21 [O. sativa]	36	862	6e-85
Cf-9 [L. pimpinellifolium]	60	656	5e-46
Cf-9 [L. pimpinellifolium]	67	489	2e-36
Cf-9 [L. pimpinellifolium]	77	690	1e-53
FLS2 [A.thaliana]	78	1059	1e-141
FLS2 [A.thaliana]	162	679	5e-80
Rpg1 [Hordeum vulgare]	768	981	1e-15
Rpg1 [Hordeum vulgare]	779	1058	4e-26
Pto [L. esculentum]	781	1051	3e-33

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	712	734	out -> in

Report for 2971.m00137

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)