Report for 2972.m00166

 > 2972.m00166, length: 342, copies: 1 

MDVKLLLLLLLSVLLLSAASMAKDDDEQQQKVQCHEDDEAALLAIDDALGNPYNLASWTRNTSCCDWYDVDCDQD

SGRVVSLSVFQDTNLTGAIPDAIANLTHLRTLLLHHLPSLSGPIPDSLAALTDLTHLTISWTAVSGPVPSFLANL

TSLTMLDLSFNSLTGLIPPSLAALTNLSAINLSRNRLSGPIPPGLFSNLQLQDDDDEVYLRLSHNNLSGSVPADL

LAAANLALVDLSRNALTGDASAVFRRARYVDLSRNGFVFNMSGVEFAEETYYVDVSHNAIRGGIPAQVANLTNLQ

TFNVSYNKMCGAVPAMPRFDAYCYQHNKCLCGAPLATACRRR

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	103	127	1.9
LRR [Pfam ls]	152	175	0.0037
LRR [Pfam ls]	176	200	0.0088

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	78	102	2.9
LRR [sensitive, ls]	78	102	77
LRR [sensitive, ls]	103	127	0.071
LRR [sensitive, ls]	103	127	1.9
LRR [sensitive, ls]	128	151	0.37
LRR [sensitive, ls]	128	151	10
LRR [sensitive, ls]	152	175	0.00014
LRR [sensitive, ls]	152	175	0.0037
LRR [sensitive, ls]	176	200	0.00032
LRR [sensitive, ls]	176	200	0.0088
LRR [sensitive, ls]	230	253	0.31
LRR [sensitive, ls]	230	253	8.3
LRR [sensitive, ls]	274	297	0.45
LRR [sensitive, ls]	274	297	12
LRR [sensitive, ls]	298	317	2.4
LRR [sensitive, ls]	298	317	65

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	5	314	3e-32
CLV2 [A. thaliana]	28	314	2e-17
FLS2 [A.thaliana]	33	315	5e-22
Cf-9 [L. pimpinellifolium]	57	315	2e-18
FLS2 [A.thaliana]	74	316	2e-21
Xa21 [O. sativa]	76	332	4e-25
FLS2 [A.thaliana]	77	314	3e-21
FLS2 [A.thaliana]	80	314	6e-23
CLV2 [A. thaliana]	86	321	2e-16
FLS2 [A.thaliana]	87	314	4e-20
Cf-9 [L. pimpinellifolium]	88	313	3e-14
Cf-9 [L. pimpinellifolium]	89	314	2e-17
Cf-9 [L. pimpinellifolium]	89	339	7e-13
FLS2 [A.thaliana]	89	333	5e-21
FLS2 [A.thaliana]	89	314	2e-20
Xa21 [O. sativa]	89	314	8e-16
CLV2 [A. thaliana]	90	327	1e-19
CLV2 [A. thaliana]	91	302	3e-20

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 2972.m00166

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)