Report for 3008.m00155

 > 3008.m00155, length: 606, copies: 1 

MRNPCIWCCLVLLTLVVCDSCLHEERKHLMDICDAFLWPAGNPPDWSSRDCCRWERVTCSSITGRVTALDLDAAY

PSWYGLLNCSMFLPFRELQNLSLGNAGIAGCMPGAGFEVWSNLRQLEILDLSENELNDSSIMPLVGLASLRSPFL

GGNAIKNDFTVQRLSKMKLDILDLSWNGIFGNISRAVCNMTSLRELHLNGNFFFGVLPSCIRNLTFLRVLDLSNN

LLTARFPTISFANMTLLEQLSLSHNQLEGLLLLNSFSNHLQLKYLRLSSNSASFQVQTENPEANISSQLQVLELS

NCNLNANSGVVPSFLSHQHGLYLIDVSNNNLSGHFPTWLLENNIYLSYLSVKHNSFVGSLILPSTVNQNLSWLDA

SYNRLSGDLPVDINITFPNLSYLNLSKNFFQGIFPSAVSHLENLSTLDLSYNNISGEITASFPTTMSMNHLVLND

NNISGEIPTSICTNVNLGVVDFSNNKLTGSIPNCIASNHLFFILNLRGNHLTGSIPTGLSSLLNLQFLDLSKNHL

SGPLPSLPNLTYLHLSENELNGTFPLVWPFGANLKTMDLRYNQFSGAIPRCIDETFPELRILLLKGNMFEGMVPN

QVCLLT

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	120	143	1.9
LRR [Pfam ls]	168	191	6.2
LRR [Pfam ls]	192	215	0.29
LRR [Pfam ls]	216	240	0.033
LRR [Pfam ls]	293	319	1.1
LRR [Pfam ls]	369	393	6
LRR [Pfam ls]	394	417	0.067
LRR [Pfam ls]	418	438	0.62
LRR [Pfam ls]	466	489	5.1
LRR [Pfam ls]	514	533	0.42
LRR [Pfam ls]	534	554	1.8

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	92	116	2.4
LRR [sensitive, ls]	92	116	55
LRR [sensitive, ls]	120	143	0.08
LRR [sensitive, ls]	120	143	1.9
LRR [sensitive, ls]	168	191	0.27
LRR [sensitive, ls]	168	191	6.2
LRR [sensitive, ls]	192	215	0.012
LRR [sensitive, ls]	192	215	0.29
LRR [sensitive, ls]	216	240	0.0014
LRR [sensitive, ls]	216	240	0.033
LRR [sensitive, ls]	241	262	0.54
LRR [sensitive, ls]	241	262	13
LRR [sensitive, ls]	293	319	0.048
LRR [sensitive, ls]	293	319	1.1
LRR [sensitive, ls]	320	344	0.49
LRR [sensitive, ls]	320	344	11
LRR [sensitive, ls]	369	393	0.26
LRR [sensitive, ls]	369	393	6
LRR [sensitive, ls]	394	417	0.0029
LRR [sensitive, ls]	394	417	0.067
LRR [sensitive, ls]	418	438	0.027
LRR [sensitive, ls]	418	438	0.62
LRR [sensitive, ls]	442	465	0.84
LRR [sensitive, ls]	442	465	20
LRR [sensitive, ls]	466	489	0.22
LRR [sensitive, ls]	466	489	5.1
LRR [sensitive, ls]	490	513	0.87
LRR [sensitive, ls]	490	513	20
LRR [sensitive, ls]	514	533	0.018
LRR [sensitive, ls]	514	533	0.42
LRR [sensitive, ls]	534	554	0.077
LRR [sensitive, ls]	534	554	1.8
LRR [sensitive, ls]	558	582	0.47
LRR [sensitive, ls]	558	582	11
LRR [sensitive, ls]	583	606	1
LRR [sensitive, ls]	583	606	24

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	39	602	3e-42
CLV2 [A. thaliana]	41	505	5e-29
CLV2 [A. thaliana]	46	598	1e-39
Cf-9 [L. pimpinellifolium]	48	602	7e-42
CLV2 [A. thaliana]	65	574	4e-36
Xa21 [O. sativa]	71	532	1e-28
FLS2 [A.thaliana]	83	599	2e-41
Cf-9 [L. pimpinellifolium]	85	530	1e-31
Cf-9 [L. pimpinellifolium]	87	575	3e-33
CLV2 [A. thaliana]	92	467	1e-16
FLS2 [A.thaliana]	93	480	4e-32
FLS2 [A.thaliana]	113	602	1e-42
Xa21 [O. sativa]	169	599	3e-35
Xa21 [O. sativa]	317	602	6e-21
FLS2 [A.thaliana]	370	605	1e-22
Xa21 [O. sativa]	381	574	3e-21
Xa21 [O. sativa]	398	602	3e-24

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 3008.m00155

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)