Report for 3023.m00116

 > 3023.m00116, length: 964, copies: 2 

MAAARAPWLWWWVVVVVGVAVAEAASGGGGGGDGEGKALMGVKAGFGNAANALVDWDGGADHCAWRGVTCDNASF

AVLALSLDISEAILFVMLKRIFVMRVFPCVKNRNLSNLNLGGEISPAIGELKNLQFVDLSGNLLYGDIPFSISKL

KQLEELILKNNQLTGPIPSTLSQIPNLKTLDLAQNQLTGDIPRLIYWNEVLQYLGLRGNSLTGTLSPDMCQLTGL

WYFDVRGNNLTGTIPESIGNCTSFEILDISYNQISGEIPYNIGFLQVATLSLQGNRLTGKIPDVIGLMQALAVLY

LHGNKLTGVIPPELGNMSKLSYLQLNDNELVGTIPAELGKLEELFELNLANNNLQGPIPANISSCTALNKFNVYG

NKLNGSIPAGFQKLESLTYLNLSSNNFKGNIPSELGHIINLDTLDLSYNEFSGPVPATIGDLEHLLELNLSKNHL

DGPVPAEFGNLRSVQVIDMSNNNLSGSLPEELGQLQNLDSLILNNNNLVGEIPAQLANCFSLNNLNLSYNNLSGH

VPMAKNFSKFPMESFLGNPLLHVYCQDSSCGHSHGQRVNISKTAIACIILGFIILLCVLLLAIYKTNQPQPLVKG

SDKPVQGPPKLVVLQMDMAIHTYEDIMRLTENLSEKYIIGYGASSTVYKCELKSGKAIAVKRLYSQYNHSLREFE

TELETIGSIRHRNLVSLHGFSLSPHGNLLFYDYMENGSLWDLLHGPSKKVKLNWDTRLRIAVGAAQGLAYLHHDC

NPRIIHRDVKSSNILLDENFEAHLSDFGIAKCVPSAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLL

ELLTGKKAVDNESNLHQLILSKADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPSDRPTMHEVARVLL

SLLPASAMTTPKTVDYSRLLASTTTAADMRGHDVTDIGDNSSSDEQWFVRFGEDCPKIVPRNLQ

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	128	151	0.12
LRR [Pfam ls]	152	175	0.17
LRR [Pfam ls]	176	198	0.88
LRR [Pfam ls]	200	223	1.3
LRR [Pfam ls]	224	247	1.8
LRR [Pfam ls]	271	294	3.1
LRR [Pfam ls]	295	318	0.029
LRR [Pfam ls]	319	342	0.18
LRR [Pfam ls]	343	366	1.3
LRR [Pfam ls]	367	390	5.3
LRR [Pfam ls]	391	414	0.2
LRR [Pfam ls]	415	438	0.13
LRR [Pfam ls]	439	462	0.67
LRR [Pfam ls]	463	486	0.017
LRR [Pfam ls]	487	510	1.1
LRR [Pfam ls]	511	536	2.4
Ser/Thr pkinase [Pfam fs]	633	830	3.8e-41
Ser/Thr pkinase [Pfam ls]	633	900	2.2e-41

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	128	151	0.0052
LRR [sensitive, ls]	128	151	0.12
LRR [sensitive, ls]	152	175	0.0073
LRR [sensitive, ls]	152	175	0.17
LRR [sensitive, ls]	176	198	0.038
LRR [sensitive, ls]	176	198	0.88
LRR [sensitive, ls]	200	223	0.056
LRR [sensitive, ls]	200	223	1.3
LRR [sensitive, ls]	224	247	0.077
LRR [sensitive, ls]	224	247	1.8
LRR [sensitive, ls]	248	268	0.61
LRR [sensitive, ls]	248	268	14
LRR [sensitive, ls]	271	294	0.13
LRR [sensitive, ls]	271	294	3.1
LRR [sensitive, ls]	295	318	0.0013
LRR [sensitive, ls]	295	318	0.029
LRR [sensitive, ls]	319	342	0.0078
LRR [sensitive, ls]	319	342	0.18
LRR [sensitive, ls]	343	366	0.054
LRR [sensitive, ls]	343	366	1.3
LRR [sensitive, ls]	367	390	0.23
LRR [sensitive, ls]	367	390	5.3
LRR [sensitive, ls]	391	414	0.0087
LRR [sensitive, ls]	391	414	0.2
LRR [sensitive, ls]	415	438	0.0057
LRR [sensitive, ls]	415	438	0.13
LRR [sensitive, ls]	439	462	0.029
LRR [sensitive, ls]	439	462	0.67
LRR [sensitive, ls]	463	486	0.00073
LRR [sensitive, ls]	463	486	0.017
LRR [sensitive, ls]	487	510	0.046
LRR [sensitive, ls]	487	510	1.1
LRR [sensitive, ls]	511	536	0.1
LRR [sensitive, ls]	511	536	2.4

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	28	719	5e-85
CLV2 [A. thaliana]	33	527	3e-50
FLS2 [A.thaliana]	35	527	2e-75
Cf-9 [L. pimpinellifolium]	54	535	9e-44
Cf-9 [L. pimpinellifolium]	101	556	1e-53
Cf-9 [L. pimpinellifolium]	110	527	2e-40
CLV2 [A. thaliana]	110	372	3e-18
FLS2 [A.thaliana]	110	902	1e-118
CLV2 [A. thaliana]	112	555	1e-47
Cf-9 [L. pimpinellifolium]	182	531	5e-27
FLS2 [A.thaliana]	230	529	2e-44
Cf-9 [L. pimpinellifolium]	271	543	2e-16
CLV2 [A. thaliana]	319	534	3e-20
Rpg1 [Hordeum vulgare]	623	902	3e-31
Pto [L. esculentum]	624	895	8e-46
Rpg1 [Hordeum vulgare]	629	895	5e-23

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	7	29	in -> out
putative TM domain	76	98	out -> in
putative TM domain	76	98	out -> in
putative TM domain	570	589	in -> out
putative TM domain	570	589	in -> out

Report for 3023.m00116

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)