Report for 3028.m00171

 > 3028.m00171, length: 980, copies: 1 

MSVMRGRMQGVWLAALISLLCHSIANAGKEAAAAVCITSERDALLAFKAGLCADSAGELPSWQGHDCCSWGSVSC

NKRTGHVIGLDIGQYALSFTGEINSSLAALTHLRYLNLSGNDFGGVAIPDFIGSFSKLRHLDLSHAGFAGLVPPQ

LGNLSMLSHLALNSSTIRMDNFHWVSRLRALRYLDLGRLYLVACSDWLQAISSLPLLQVLRLNDAFLPATSLNSV

SYVNFTALTVLDLSNNELNSTLPRWIWSLHSLSYLDLSSCQLSGSVPDNIGNLSSLSFLQLLDNHLEGEIPQHMS

RLCSLNIIDMSRNNLSGNITAEKNLFSCMKELQVLKVGFNNLTGNLSGWLEHLTGLTTLDLSKNSFTGQIPEDIG

KLSQLIYLDLSYNAFGGRLSEVHLGNLSRLDFLSLASNKLKIVIEPNWMPTFQLTGLGLHGCHVGPHIPAWLRSQ

TKIKMIDLGSTKITGTLPDWLWNFSSSITTLDISSNSITGHLPTSLVHMKMLSTFNMRSNVLEGGIPGLPASVKV

LDLSKNFLSGSLPQSLGAKYAYYIKLSDNQLNGTIPAYLCEMDSMELVDLSNNLFSGVLPDCWKNSSRLHTIDFS

NNNLHGEIPSTMGFITSLAILSLRENSLSGTLPSSLQSCNGLIILDLGSNSLSGSLPSWLGDSLGSLITLSLRSN

QFSGEIPESLPQLHALQNLDLASNKLSGPVPQFLGNLTSMCVDHGYAVMIPSAKFATVYTDGRTYLAIHVYTDKL

ESYSSTYDYPLNFIDLSRNQFTGEIPREIGAISFLLALNLSGNHILGSIPDEIGNLSHLEALDLSSNDLSGSIPP

SITDLINLSVLNLSYNDLSGVIPCSSQFSTFTDEPYLGNADLCGNCGASLSRICSQHTTTRKHQNMIDRGTYLCT

LLGFAYGLSVVSAILIFSRTARNAYFQFTDKTLDEFRAIVQIKLNRIKAGRRQSMEIYRLGSQNSITCYELEFGY

TTEGN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	107	131	0.19
LRR [Pfam ls]	132	155	1.3
LRR [Pfam ls]	232	255	0.22
LRR [Pfam ls]	256	279	0.027
LRR [Pfam ls]	304	330	3.8
LRR [Pfam ls]	331	354	2.7
LRR [Pfam ls]	355	378	0.015
LRR [Pfam ls]	379	403	1.1
LRR [Pfam ls]	477	500	0.25
LRR [Pfam ls]	522	542	4.9
LRR [Pfam ls]	569	592	3.5
LRR [Pfam ls]	593	615	5.1
LRR [Pfam ls]	617	640	2.3
LRR [Pfam ls]	641	665	6.8
LRR [Pfam ls]	666	689	1.3
LRR [Pfam ls]	690	713	0.091
LRR [Pfam ls]	784	807	0.84
LRR [Pfam ls]	808	831	0.06
LRR [Pfam ls]	832	855	0.79

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	107	131	0.0082
LRR [sensitive, ls]	107	131	0.19
LRR [sensitive, ls]	132	155	0.054
LRR [sensitive, ls]	132	155	1.3
LRR [sensitive, ls]	180	211	4.4
LRR [sensitive, ls]	180	211	100
LRR [sensitive, ls]	232	255	0.0093
LRR [sensitive, ls]	232	255	0.22
LRR [sensitive, ls]	256	279	0.0012
LRR [sensitive, ls]	256	279	0.027
LRR [sensitive, ls]	280	300	1.8
LRR [sensitive, ls]	280	300	42
LRR [sensitive, ls]	304	330	0.16
LRR [sensitive, ls]	304	330	3.8
LRR [sensitive, ls]	331	354	0.11
LRR [sensitive, ls]	331	354	2.7
LRR [sensitive, ls]	355	378	0.00066
LRR [sensitive, ls]	355	378	0.015
LRR [sensitive, ls]	379	403	0.046
LRR [sensitive, ls]	379	403	1.1
LRR [sensitive, ls]	404	424	3.6
LRR [sensitive, ls]	404	424	84
LRR [sensitive, ls]	428	451	1.4
LRR [sensitive, ls]	428	451	32
LRR [sensitive, ls]	452	475	0.35
LRR [sensitive, ls]	452	475	8.2
LRR [sensitive, ls]	477	500	0.011
LRR [sensitive, ls]	477	500	0.25
LRR [sensitive, ls]	522	542	0.21
LRR [sensitive, ls]	522	542	4.9
LRR [sensitive, ls]	569	592	0.15
LRR [sensitive, ls]	569	592	3.5
LRR [sensitive, ls]	593	615	0.22
LRR [sensitive, ls]	593	615	5.1
LRR [sensitive, ls]	617	640	0.099
LRR [sensitive, ls]	617	640	2.3
LRR [sensitive, ls]	641	665	0.29
LRR [sensitive, ls]	641	665	6.8
LRR [sensitive, ls]	666	689	0.054
LRR [sensitive, ls]	666	689	1.3
LRR [sensitive, ls]	690	713	0.0039
LRR [sensitive, ls]	690	713	0.091
LRR [sensitive, ls]	760	783	0.86
LRR [sensitive, ls]	760	783	20
LRR [sensitive, ls]	784	807	0.036
LRR [sensitive, ls]	784	807	0.84
LRR [sensitive, ls]	808	831	0.0026
LRR [sensitive, ls]	808	831	0.06
LRR [sensitive, ls]	832	855	0.034
LRR [sensitive, ls]	832	855	0.79

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	11	706	3e-56
FLS2 [A.thaliana]	31	916	5e-86
CLV2 [A. thaliana]	40	714	2e-52
Cf-9 [L. pimpinellifolium]	61	948	4e-86
CLV2 [A. thaliana]	232	868	1e-54
Xa21 [O. sativa]	255	918	2e-57
Xa21 [O. sativa]	498	869	6e-38
Xa21 [O. sativa]	589	848	2e-22

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	896	918	out -> in
putative TM domain	896	918	out -> in

Report for 3028.m00171

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)