Report for 3028.m00173

 > 3028.m00173, length: 961, copies: 1 

MRLALISLLPLLLVASKITAAAACIGKERDALFDLKATLRDPGGMLSSWVGLNCCNWYGVTCNNRTGHIIKLNLA

NYNISKEDALTGDISPSLVHLTHLMYLNLRSNDFGGARIPAFIGSLKNLRHLDLSFANFGGKIPPQLGNLSKLNY

LDISFPYNNFSSFTSSSSVDNLLWVSQLSSLVYLDMSLWNLSVASDWLQSLNMLASLKVLRLSGTNLPPTNQNSL

SQSNFTVLNEIDLSGNNFSSRFPNWLASIYTLSLINLDYCELHGSIPESVGNLTALNTLYLADNSLIGAIPISKL

CNLQILDLSNNNLIGDIADLGKAMTRCMKGLSMIKLGNNNLSGSLSGWIGSFPNLFSVDLSKNSLSGHVHTNISQ

LTELIELDLSHNSLEDVLSEQHLTNLTKLKKLDLSYNSLRISVGANWLPPFQLYELLLGSSPLQSQVPQWLQTQV

GMQTLDLHRTGTLGQLPDWLWTSLTSLINLDLSDNLLTGMLPASLVHMKSLQFLGLSSNQLEGQIPDMPESLDLL

DLSNNSLSGSLPNSVGGNKTRYILLSSNRLNRSIPAYFCNMPWLSAIDLSNNSLSGELPNCWKNSTELFLVDFSY

NNLEGHIPSSLGSLTFLGSLHLNNNRLSGLLPSSLSSCGLLVFLDIGDNNLEGSIPEWIGDNMQYLMILRLRSNR

FTGSIPSELSQLQGLQVLDLANNKLSGPLPQGIGNFSEMASQRSRHIIPMQISGDSFGGSLYHNESLYITIKGEE

RLYSKILYLMKSIDLSNNYLTGGIPAEVGDLVGLKNLNLSKNLLSGHIPETIGNMSSLESLDLSWNRLSGIIPES

MTSLHLLSHLNMSYNNLSGMVPQGSQLQTLGDEDPYIYAGNKYLCIHLASGSCFEQKDNHVDQAEHNDVHDIWLY

IFSGLGFGVGFSSVWWLLVCSKAVGKRYFQFVDSTCEKVIHWMILLEKKVNKKTVGKSSVL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	123	146	0.018
LRR [Pfam ls]	256	279	3.3
LRR [Pfam ls]	302	325	0.055
LRR [Pfam ls]	378	402	0.18
LRR [Pfam ls]	403	427	0.78
LRR [Pfam ls]	476	499	0.29
LRR [Pfam ls]	521	541	4.8
LRR [Pfam ls]	544	567	6.1
LRR [Pfam ls]	592	615	1.6
LRR [Pfam ls]	616	639	3.1
LRR [Pfam ls]	640	664	3.2
LRR [Pfam ls]	689	712	0.16
LRR [Pfam ls]	759	782	2.3
LRR [Pfam ls]	783	806	0.16
LRR [Pfam ls]	807	830	0.008

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	68	97	3.3
LRR [sensitive, ls]	68	97	76
LRR [sensitive, ls]	98	122	0.52
LRR [sensitive, ls]	98	122	12
LRR [sensitive, ls]	123	146	0.00076
LRR [sensitive, ls]	123	146	0.018
LRR [sensitive, ls]	206	231	1.3
LRR [sensitive, ls]	206	231	30
LRR [sensitive, ls]	232	255	1.2
LRR [sensitive, ls]	232	255	28
LRR [sensitive, ls]	256	279	0.14
LRR [sensitive, ls]	256	279	3.3
LRR [sensitive, ls]	280	301	1.1
LRR [sensitive, ls]	280	301	25
LRR [sensitive, ls]	302	325	0.0024
LRR [sensitive, ls]	302	325	0.055
LRR [sensitive, ls]	330	353	0.71
LRR [sensitive, ls]	330	353	17
LRR [sensitive, ls]	354	377	0.43
LRR [sensitive, ls]	354	377	9.9
LRR [sensitive, ls]	378	402	0.0075
LRR [sensitive, ls]	378	402	0.18
LRR [sensitive, ls]	403	427	0.034
LRR [sensitive, ls]	403	427	0.78
LRR [sensitive, ls]	451	475	0.72
LRR [sensitive, ls]	451	475	17
LRR [sensitive, ls]	476	499	0.012
LRR [sensitive, ls]	476	499	0.29
LRR [sensitive, ls]	500	519	0.67
LRR [sensitive, ls]	500	519	16
LRR [sensitive, ls]	521	541	0.21
LRR [sensitive, ls]	521	541	4.8
LRR [sensitive, ls]	544	567	0.26
LRR [sensitive, ls]	544	567	6.1
LRR [sensitive, ls]	568	591	2.9
LRR [sensitive, ls]	568	591	68
LRR [sensitive, ls]	592	615	0.069
LRR [sensitive, ls]	592	615	1.6
LRR [sensitive, ls]	616	639	0.13
LRR [sensitive, ls]	616	639	3.1
LRR [sensitive, ls]	640	664	0.14
LRR [sensitive, ls]	640	664	3.2
LRR [sensitive, ls]	665	688	0.37
LRR [sensitive, ls]	665	688	8.6
LRR [sensitive, ls]	689	712	0.0067
LRR [sensitive, ls]	689	712	0.16
LRR [sensitive, ls]	759	782	0.1
LRR [sensitive, ls]	759	782	2.3
LRR [sensitive, ls]	783	806	0.0071
LRR [sensitive, ls]	783	806	0.16
LRR [sensitive, ls]	807	830	0.00035
LRR [sensitive, ls]	807	830	0.008
LRR [sensitive, ls]	831	853	0.34
LRR [sensitive, ls]	831	853	7.8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	8	870	1e-85
CLV2 [A. thaliana]	23	581	7e-37
CLV2 [A. thaliana]	27	657	6e-57
Xa21 [O. sativa]	31	657	4e-49
Cf-9 [L. pimpinellifolium]	53	915	6e-83
Xa21 [O. sativa]	155	831	9e-54
CLV2 [A. thaliana]	186	909	1e-54
Xa21 [O. sativa]	379	857	5e-50
CLV2 [A. thaliana]	504	855	8e-33
Xa21 [O. sativa]	641	863	4e-20

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	897	919	out -> in
putative TM domain	897	919	out -> in

Report for 3028.m00173

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)