Report for 3091.m00135

 > 3091.m00135, length: 940, copies: 1 

MENTMNGLLMALALLCLTINFREIAACISTERDALVAFNTSIKDPDGRLHSWHGENCCSWSGVSCSKKTGHVIKL

DLGEYTLNGQINPSLSGLTRLVYLNLSQSDFGGVPIPEFIGCFKMLRYLDLSHAGFGGTVPPQLGNLSRLSFLDL

SSSGSHVITADDFQWVSKLTSLRYLDLSWLYLAASVDWLQAVNMLHLLEVLRLNDASLPATDLNSVSQINFTALK

VIDLKNNELNSSLPDWIWNLSSLSDLDLSSCELSGRIPDELGKLAALQFIGLGNNKLNGAIPRSMSRLCNLVHID

LSRNILSGNLSEAARSMFPCMKKLQILNLADNKLTGQLSGWCEHMASLEVLDLSENSLSGVLPTSISRLSNLTYL

DISFNKLIGELSELHFTNLSRLDALVLASNSFKVVVKHSWFPPFQLTKLGLHGCLVGPQFPTWLQSQTRIKMIDL

GSAGIRGALPDWIWNFSSPMASLNVSMNNITGELPASLVRSKMLITLNIRHNQLEGYIPDMPNSVRVLDLSHNNL

SGSLPQSFGDKELQYLSLSHNSLSGVIPAYLCDIISMELIDISNNNLSGELPNCWRMNSSMYVIDFSSNNFWGEI

PSTMGSLSSLTALHLSKNSLSGLLPTSLQSCKRLLVLDVGENNLSGYIPTWIGNGLQTLLLLILGSNQFSGEIPE

ELSQLHALQYLDLSNNKLSGSIPRSLGKLTSFLSRNLEWDSSPFFQFMVYGVGGAYFSVYKDTLQATFRGYRLTF

VISFLLTSIDLSENHLTGEIPSEIGNLYRLASLNLSRNHIEGSIPETIGNLAWLESLDLSWNDLSGPIPQSMKSL

LFLSFLNLSYNHLSGKIPYGNQLMTFEGDSFLGNEDLCGAPLTRSCHKDSDKHKHHEIFDTLTYMFTLLGFAFGF

CTVSTTFIFSAASRRAYFQFTDNICNWLVAVLERKLSLIR

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	120	143	0.76
LRR [Pfam ls]	223	246	3.5
LRR [Pfam ls]	247	270	0.19
LRR [Pfam ls]	295	322	4.9
LRR [Pfam ls]	323	346	1.6
LRR [Pfam ls]	347	370	0.015
LRR [Pfam ls]	371	395	0.093
LRR [Pfam ls]	514	534	0.14
LRR [Pfam ls]	537	560	0.55
LRR [Pfam ls]	561	583	1.2
LRR [Pfam ls]	609	632	0.092
LRR [Pfam ls]	658	681	4.4
LRR [Pfam fs]	682	705	4e-05
LRR [Pfam ls]	682	705	0.00067
LRR [Pfam ls]	755	778	0.33
LRR [Pfam ls]	779	802	0.054

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	95	119	0.42
LRR [sensitive, ls]	95	119	11
LRR [sensitive, ls]	120	143	0.029
LRR [sensitive, ls]	120	143	0.76
LRR [sensitive, ls]	171	193	3.3
LRR [sensitive, ls]	171	193	88
LRR [sensitive, ls]	223	246	0.13
LRR [sensitive, ls]	223	246	3.5
LRR [sensitive, ls]	247	270	0.0073
LRR [sensitive, ls]	247	270	0.19
LRR [sensitive, ls]	271	291	1.5
LRR [sensitive, ls]	271	291	41
LRR [sensitive, ls]	295	322	0.18
LRR [sensitive, ls]	295	322	4.9
LRR [sensitive, ls]	323	346	0.061
LRR [sensitive, ls]	323	346	1.6
LRR [sensitive, ls]	347	370	0.00055
LRR [sensitive, ls]	347	370	0.015
LRR [sensitive, ls]	371	395	0.0035
LRR [sensitive, ls]	371	395	0.093
LRR [sensitive, ls]	420	443	2.4
LRR [sensitive, ls]	420	443	65
LRR [sensitive, ls]	444	467	2.3
LRR [sensitive, ls]	444	467	60
LRR [sensitive, ls]	493	512	1.3
LRR [sensitive, ls]	493	512	35
LRR [sensitive, ls]	514	534	0.0054
LRR [sensitive, ls]	514	534	0.14
LRR [sensitive, ls]	537	560	0.021
LRR [sensitive, ls]	537	560	0.55
LRR [sensitive, ls]	561	583	0.044
LRR [sensitive, ls]	561	583	1.2
LRR [sensitive, ls]	585	608	0.85
LRR [sensitive, ls]	585	608	22
LRR [sensitive, ls]	609	632	0.0035
LRR [sensitive, ls]	609	632	0.092
LRR [sensitive, ls]	633	657	0.41
LRR [sensitive, ls]	633	657	11
LRR [sensitive, ls]	658	681	0.17
LRR [sensitive, ls]	658	681	4.4
LRR [sensitive, ls]	682	705	2.5e-05
LRR [sensitive, ls]	682	705	0.00067
LRR [sensitive, ls]	755	778	0.012
LRR [sensitive, ls]	755	778	0.33
LRR [sensitive, ls]	779	802	0.002
LRR [sensitive, ls]	779	802	0.054
LRR [sensitive, ls]	803	826	1.4
LRR [sensitive, ls]	803	826	36
LRR [sensitive, ls]	827	850	0.3
LRR [sensitive, ls]	827	850	7.9

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	5	878	7e-93
CLV2 [A. thaliana]	31	655	2e-51
Xa21 [O. sativa]	34	716	5e-52
Cf-9 [L. pimpinellifolium]	48	922	1e-88
Xa21 [O. sativa]	58	287	4e-12
Xa21 [O. sativa]	89	531	3e-23
Xa21 [O. sativa]	196	910	1e-59
CLV2 [A. thaliana]	223	917	1e-59

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	889	911	out -> in

Report for 3091.m00135

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)