Report for 3104.m00106

 > 3104.m00106, length: 385, copies: 1 

MGGVSGKLVWVLLVMCSSWLIAAVHAQQAATTDPIEVAALEAILGRWGKTTSPLWRMSGEPCRGVPVDGSTDLDG

NPKNNPGIKCDCSYNSGTVCHITQLRVYALNVVGQIPAELQNLTYLTYLNLDQNYLSGPIPSFIGQLTALTELHV

GFNPLSGSLPKELGNLTNLNLLGISLTNFTGELPEELGNLSKLKYLGISLTNFSGQLPEELGNLTKLRQLYTDSA

GLSGPFPSTLSRLKNLKLLRASDNNFTGTIPDFIGSLSNLEDLRIGDIVNGSSSLAFISSLTSLDTLVLRNCKIS

GDLGAVDFSKFANLTFLDLSFNNISGNVPKSILNLQKLIFLFLGNNSLTGELPDGISPSLTNLDFSYNQLTGSFP

SWVTQNNLQL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	120	143	0.29
LRR [Pfam ls]	144	167	0.21
LRR [Pfam ls]	240	263	0.13
LRR [Pfam ls]	288	312	4.8
LRR [Pfam ls]	313	336	0.035
LRR [Pfam ls]	359	383	1

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	96	119	1.2
LRR [sensitive, ls]	96	119	32
LRR [sensitive, ls]	120	143	0.011
LRR [sensitive, ls]	120	143	0.29
LRR [sensitive, ls]	144	167	0.0081
LRR [sensitive, ls]	144	167	0.21
LRR [sensitive, ls]	168	191	0.65
LRR [sensitive, ls]	168	191	17
LRR [sensitive, ls]	192	215	0.29
LRR [sensitive, ls]	192	215	7.7
LRR [sensitive, ls]	240	263	0.005
LRR [sensitive, ls]	240	263	0.13
LRR [sensitive, ls]	288	312	0.18
LRR [sensitive, ls]	288	312	4.8
LRR [sensitive, ls]	313	336	0.0013
LRR [sensitive, ls]	313	336	0.035
LRR [sensitive, ls]	337	357	0.34
LRR [sensitive, ls]	337	357	9.1
LRR [sensitive, ls]	359	383	0.038
LRR [sensitive, ls]	359	383	1

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	78	375	9e-18
FLS2 [A.thaliana]	79	379	1e-32
Cf-9 [L. pimpinellifolium]	86	385	2e-28
CLV2 [A. thaliana]	87	375	7e-26
FLS2 [A.thaliana]	88	373	4e-26
Cf-9 [L. pimpinellifolium]	91	375	1e-15
FLS2 [A.thaliana]	92	375	6e-39
FLS2 [A.thaliana]	92	375	4e-38
Xa21 [O. sativa]	92	376	2e-28
Xa21 [O. sativa]	92	354	2e-25
FLS2 [A.thaliana]	93	380	2e-32
Cf-9 [L. pimpinellifolium]	94	383	5e-29
Xa21 [O. sativa]	94	380	2e-28
FLS2 [A.thaliana]	96	375	9e-32
Cf-9 [L. pimpinellifolium]	100	378	6e-22
CLV2 [A. thaliana]	100	365	2e-20
FLS2 [A.thaliana]	106	383	6e-33
CLV2 [A. thaliana]	107	372	2e-26
CLV2 [A. thaliana]	108	378	2e-28
CLV2 [A. thaliana]	109	375	1e-20
CLV2 [A. thaliana]	124	380	2e-20
Cf-9 [L. pimpinellifolium]	137	376	2e-21

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 3104.m00106

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)