Report for 3105.m00116

 > 3105.m00116, length: 760, copies: 1 

MGLEGAVPEDTVGKLARLRSLDLSGNRLAALPNDLWEVGASLLELNLSRNAIRGDLPNNIVNFAALQVLDVSHNA

FSGALPPALGSIAALRVLDASHNLFQGQLLGTVISGWTNLSSMDLSGNALDGDLPDLSPLLSLSYLNLSGNRLRG

SVIGAFHEQMKVIDLSNNSFSGLNFSSGYAGSSLAYLDLSGNELTGEFSVGNRFQNLKHLNLAFNQLSVANLLVS

MGEISGLEFVNLSSTGLHGQIPRELSSQLSRLKVLDLSRNNISGVVPDLSSIRLQVLDLSVNNLTGEIPVALVKK

LVSMERFNFSYNNLTVCASELSPEAFAAAFARSRNDCPIAVNPDRIQRSGGKRKGMKLALAIVLSLFFSVLGLLC

VAVACRRRRKRGDVLPAVKQVSFKEEPGISGPFAFQTDSTTWVADVKVATSVPVVIFEKPLLSFTFADLLAATSN

FDRGTLLAEGRFGPVYRGFLPGGIQVAVKVLVHGSAMADQDAARELERLGRIKHPNLVPLTGYCLAGEQRIAIYE

YMENGNLHNLLHDLPLGVQTTEDWSTDTWEDNNGGVATENITPEGTATWMFRHKIALGAARALAFLHHGCIPQIV

HRDVKASSIYFDCGMEPRLSDFGLSMIAGTSTDNNLLHHSPGYAPPEFSDSENAMATAKSDVYSFGVVLFELITG

KKPLGDDYPGQKEASLVNWARAMVKANLGPGIIDPKIRDTGLERQMEEALRIAYLCTAELPSKRPAMQQIVGLLK

DIEPKVAEQD

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	17	40	0.059
LRR [Pfam ls]	41	64	1.4
LRR [Pfam ls]	65	88	1.2
LRR [Pfam ls]	89	113	5.4
LRR [Pfam ls]	114	136	2.5
LRR [Pfam ls]	137	157	6.1
LRR [Pfam ls]	183	208	0.045
LRR [Pfam ls]	256	275	0.097
LRR [Pfam ls]	278	302	0.031
Ser/Thr pkinase [Pfam fs]	451	681	1.1e-25
Ser/Thr pkinase [Pfam ls]	451	749	2.6e-22

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	17	40	0.0022
LRR [sensitive, ls]	17	40	0.059
LRR [sensitive, ls]	41	64	0.051
LRR [sensitive, ls]	41	64	1.4
LRR [sensitive, ls]	65	88	0.045
LRR [sensitive, ls]	65	88	1.2
LRR [sensitive, ls]	89	113	0.2
LRR [sensitive, ls]	89	113	5.4
LRR [sensitive, ls]	114	136	0.095
LRR [sensitive, ls]	114	136	2.5
LRR [sensitive, ls]	137	157	0.23
LRR [sensitive, ls]	137	157	6.1
LRR [sensitive, ls]	159	180	0.97
LRR [sensitive, ls]	159	180	26
LRR [sensitive, ls]	183	208	0.0017
LRR [sensitive, ls]	183	208	0.045
LRR [sensitive, ls]	231	255	0.37
LRR [sensitive, ls]	231	255	9.8
LRR [sensitive, ls]	256	275	0.0037
LRR [sensitive, ls]	256	275	0.097
LRR [sensitive, ls]	278	302	0.0012
LRR [sensitive, ls]	278	302	0.031
LRR [sensitive, ls]	303	330	0.51
LRR [sensitive, ls]	303	330	14

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	3	294	8e-22
Cf-9 [L. pimpinellifolium]	3	310	1e-18
Cf-9 [L. pimpinellifolium]	3	314	2e-18
Cf-9 [L. pimpinellifolium]	3	315	1e-16
CLV2 [A. thaliana]	3	196	1e-10
FLS2 [A.thaliana]	3	312	6e-25
FLS2 [A.thaliana]	3	315	3e-23
FLS2 [A.thaliana]	3	337	6e-18
FLS2 [A.thaliana]	5	755	2e-53
Xa21 [O. sativa]	11	314	4e-21
CLV2 [A. thaliana]	12	293	1e-21
Xa21 [O. sativa]	16	537	9e-31
CLV2 [A. thaliana]	17	312	5e-25
CLV2 [A. thaliana]	21	322	4e-23
FLS2 [A.thaliana]	38	315	2e-17
Cf-9 [L. pimpinellifolium]	40	315	1e-11
CLV2 [A. thaliana]	42	315	8e-27
Rpg1 [Hordeum vulgare]	419	753	5e-21
Pto [L. esculentum]	439	750	2e-34
Rpg1 [Hordeum vulgare]	439	752	1e-20

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	358	380	out -> in

Report for 3105.m00116

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)