Report for 3117.m00125

 > 3117.m00125, length: 1030, copies: 2 

MCDRQRRPVPPLGTLRSSWLLILVVHSCLSSFAVHPAAAAASSSSPSNTDFQTLLCLKLHLSNDPGGFLGSWKQN

DSIGFCRWPGVTCSKTNTSRVVALDLGSSGLNGQIPPCITNLTLLARIHFPDNQLSGQIPPELGQLSRLGYLNLS

SNSLSGSIPNTLSSTYLEVIDLESNKLTGGIPGELGMLRNLSVLNLAGNSLTGNIPISLGSSTSLVSVVLANNTL

TGPIPSVLANCSSLQVLNLVSNNLGGGIPPALFNSTSLRRLNLGWNNFTGSIPDVSNVDSPLQYLTLSVNGLTGT

IPSSLGNFSSLRLLYLAANHFQGSIPVSISKLPNLQELDISYNYLPGTVPPSIFNISSLTYLSLAVNDFTNTLPF

GIGYTLPNIQTLILQQGNFQGKIPASLANATNLESINLGANAFNGIIPSFGSLYKLKQLILASNQLEAGDWSFMS

SLANCTRLEVLSLATNKLQGSLPSSIGSLANTLGALWLHANEISGPIPPETGSLTNLVWLRMEQNYIVGNVPGTI

GNLANLNSLDLSRNKLSGQIPHSIGKLGQLNELFLQDNNFSGPIPSALGDCKKLVNLNLSCNTLNGSIPKELFSL

YSLTTGLDLSHNQLSAQIPQEVGSLINIGLLNFSNNHISGKIPTTLGACVRLESLHLEGNFLDGTIPDSFVNLKG

ISEIDLSRNNLSGEIPNFFQSFNSLKLLNLSFNNLEGQMPEGGIFQNSSEVFVQGNIMLCSSSPMLQLPLCLASS

RHRHTSRNLKIIGISVALVLVSLSCVAFIILKRSKRSKQSDRHSFTEMKNFSYADLVKATNGFSSDNLLGSGTYG

SVYKGILDSEANGIVAIKVFNLDELGAPKSFVAECEAFRNTRHRNLVRVISACSTWDNKGNDFKALIIEYMANGT

LESWIYSEMREPLSLDSRVTIAVDIAAALDYLHNRCMPPIVHCDLKPSNVLLDNAMGARLSDFGLAKFLPTHNST

SITSSTSLGGPRGSIGYIAPGAVSTSKFSTFGSVFPPKVTSCRVLPQKPRSHRVL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	143	163	2.1
LRR [Pfam ls]	166	189	1.2
LRR [Pfam ls]	190	213	0.46
LRR [Pfam ls]	214	237	2.1
LRR [Pfam ls]	238	261	0.087
LRR [Pfam ls]	262	284	1.5
LRR [Pfam ls]	286	309	2.7
LRR [Pfam ls]	310	333	0.22
LRR [Pfam ls]	334	357	0.25
LRR [Pfam ls]	407	429	5
LRR [Pfam ls]	457	480	1.1
LRR [Pfam ls]	530	553	0.033
LRR [Pfam ls]	554	577	0.14
LRR [Pfam ls]	578	602	0.22
LRR [Pfam ls]	627	650	6.4
LRR [Pfam ls]	651	674	0.047
LRR [Pfam ls]	675	698	0.17
LRR [Pfam ls]	699	723	0.89
Ser/Thr pkinase [Pfam fs]	813	995	6.1e-38
Ser/Thr pkinase [Pfam ls]	813	1030	6.5e-14

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	95	118	0.7
LRR [sensitive, ls]	95	118	18
LRR [sensitive, ls]	119	142	0.44
LRR [sensitive, ls]	119	142	12
LRR [sensitive, ls]	143	163	0.08
LRR [sensitive, ls]	143	163	2.1
LRR [sensitive, ls]	166	189	0.044
LRR [sensitive, ls]	166	189	1.2
LRR [sensitive, ls]	190	213	0.018
LRR [sensitive, ls]	190	213	0.46
LRR [sensitive, ls]	214	237	0.078
LRR [sensitive, ls]	214	237	2.1
LRR [sensitive, ls]	238	261	0.0033
LRR [sensitive, ls]	238	261	0.087
LRR [sensitive, ls]	262	284	0.055
LRR [sensitive, ls]	262	284	1.5
LRR [sensitive, ls]	286	309	0.1
LRR [sensitive, ls]	286	309	2.7
LRR [sensitive, ls]	310	333	0.0083
LRR [sensitive, ls]	310	333	0.22
LRR [sensitive, ls]	334	357	0.0093
LRR [sensitive, ls]	334	357	0.25
LRR [sensitive, ls]	358	382	0.42
LRR [sensitive, ls]	358	382	11
LRR [sensitive, ls]	383	406	0.41
LRR [sensitive, ls]	383	406	11
LRR [sensitive, ls]	407	429	0.19
LRR [sensitive, ls]	407	429	5
LRR [sensitive, ls]	430	456	0.73
LRR [sensitive, ls]	430	456	19
LRR [sensitive, ls]	457	480	0.043
LRR [sensitive, ls]	457	480	1.1
LRR [sensitive, ls]	482	505	1.2
LRR [sensitive, ls]	482	505	31
LRR [sensitive, ls]	506	529	0.39
LRR [sensitive, ls]	506	529	10
LRR [sensitive, ls]	530	553	0.0012
LRR [sensitive, ls]	530	553	0.033
LRR [sensitive, ls]	554	577	0.0052
LRR [sensitive, ls]	554	577	0.14
LRR [sensitive, ls]	578	602	0.0083
LRR [sensitive, ls]	578	602	0.22
LRR [sensitive, ls]	603	626	0.56
LRR [sensitive, ls]	603	626	15
LRR [sensitive, ls]	627	650	0.24
LRR [sensitive, ls]	627	650	6.4
LRR [sensitive, ls]	651	674	0.0018
LRR [sensitive, ls]	651	674	0.047
LRR [sensitive, ls]	675	698	0.0064
LRR [sensitive, ls]	675	698	0.17
LRR [sensitive, ls]	699	723	0.034
LRR [sensitive, ls]	699	723	0.89

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	15	716	2e-95
CLV2 [A. thaliana]	32	642	3e-56
Cf-9 [L. pimpinellifolium]	71	716	2e-53
CLV2 [A. thaliana]	82	441	5e-33
Cf-9 [L. pimpinellifolium]	87	643	1e-53
FLS2 [A.thaliana]	89	563	2e-53
Cf-9 [L. pimpinellifolium]	94	731	1e-65
FLS2 [A.thaliana]	99	1010	1e-141
Xa21 [O. sativa]	215	920	1e-150
Cf-9 [L. pimpinellifolium]	226	739	1e-39
CLV2 [A. thaliana]	271	730	4e-51
Pto [L. esculentum]	790	995	2e-19
Rpg1 [Hordeum vulgare]	799	1023	2e-21

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	761	780	out -> in

Report for 3117.m00125

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)