Report for 3127.m00130

 > 3127.m00130, length: 1030, copies: 1 

MSRNQLSDAGLLNYSLTGCHGIQYLNLSANQFTGSLPGLAPCTEVSVLDLSWNLMSGVLPPRFVAMAPANLTYLS

IAGNNFSMDISDYEFGGCANLTLLDWSYNRLRSTGLPRSLVDCRRLEALDMSGNKLLSGPIPTFLVELQALRRLS

LAGNRFTGEISDKLSILCKTLVELDLSSNQLIGSLPASFGQCRFLQVLDLGNNQLSGDFVETVITNISSLRVLRL

PFNNITGANPLPALASRCPLLEVIDLGSNEFDGEIMPDLCSSLPSLRKLLLPNNYINGTVPSSLSNCVNLESIDL

SFNLLVGQIPPEILFLLKLVDLVLWANNLSGEIPDKFCFNSTALETLVISYNSFTGNIPESITRCVNLIWLSLAG

NNLTGSIPSGFGNLQNLAILQLNKNSLSGKVPAELGSCSNLIWLDLNSNELTGTIPPQLAAQAGLITGAIVSGKQ

FAFLRNEAGNICPGAGVLFEFLDIRPDRLANFPAVHLCSSTRIYTGTTVYTFRNNGSMIFLDLSYNSLTGTIPAS

FGNMTYLEVLNLGHNELTGAIPDAFTGLKGIGALDLSHNHLTGVIPPGFGCLHFLADFDVSNNNLTGEIPTSGQL

ITFPASRYENNSGLCGIPLNPCVHNSGAGGLPQTSYGHRNFARQSVFLAVTLSVLILFSLLIIHYKLWKFHKNKT

KEIQAGCSESLPGSSKSSWKLSGIGEPLSINMAIFENPLRKLTFSDLHQATNGFCAETLIGSGGFGEVYKAKLKD

GNIVAVKKLMHFTGQGDREFTAEMETIGKIKHRNLVPLLGYCKIGDERLLVYEYMKNGSLDFVLHDKGEANMDLN

WATRKKIAIGSARGLAFLHHSCVPHIIHRDMKSSNVLLDGNFDAYVSDFGMARLMNALDSHLTVSMLSGTPGYVP

PEYCQDFRCTTKGDVYSYGVVLLELLTGKKPIDPTEFGDSNLVGWVKQMVEDRCSEIYDPTLMATTSSELELYQY

LKIACRCLDDQPNRRPTMIQVMTMFKEFQVDSGSNFLDDFSLNSTNMEESSEKSV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	21	43	0.48
LRR [Pfam ls]	70	94	2.1
LRR [Pfam ls]	120	144	3.8
LRR [Pfam ls]	145	165	4.1
LRR [Pfam ls]	170	193	0.067
LRR [Pfam ls]	194	218	0.8
LRR [Pfam ls]	219	240	3.7
LRR [Pfam ls]	245	269	1.1
LRR [Pfam ls]	270	293	3.9
LRR [Pfam ls]	294	317	0.8
LRR [Pfam ls]	367	390	0.0023
LRR [Pfam ls]	391	414	3.4
LRR [Pfam ls]	415	435	0.24
LRR [Pfam ls]	507	530	0.012
LRR [Pfam ls]	531	554	0.0016
LRR [Pfam ls]	555	578	0.096
Ser/Thr pkinase [Pfam fs]	729	1000	4.1e-48
Ser/Thr pkinase [Pfam ls]	729	1000	1.2e-48

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	21	43	0.019
LRR [sensitive, ls]	21	43	0.48
LRR [sensitive, ls]	44	67	0.76
LRR [sensitive, ls]	44	67	19
LRR [sensitive, ls]	70	94	0.081
LRR [sensitive, ls]	70	94	2.1
LRR [sensitive, ls]	95	119	2.6
LRR [sensitive, ls]	95	119	66
LRR [sensitive, ls]	120	144	0.15
LRR [sensitive, ls]	120	144	3.8
LRR [sensitive, ls]	145	165	0.16
LRR [sensitive, ls]	145	165	4.1
LRR [sensitive, ls]	170	193	0.0026
LRR [sensitive, ls]	170	193	0.067
LRR [sensitive, ls]	194	218	0.031
LRR [sensitive, ls]	194	218	0.8
LRR [sensitive, ls]	219	240	0.14
LRR [sensitive, ls]	219	240	3.7
LRR [sensitive, ls]	245	269	0.044
LRR [sensitive, ls]	245	269	1.1
LRR [sensitive, ls]	270	293	0.15
LRR [sensitive, ls]	270	293	3.9
LRR [sensitive, ls]	294	317	0.031
LRR [sensitive, ls]	294	317	0.8
LRR [sensitive, ls]	318	342	0.36
LRR [sensitive, ls]	318	342	9.3
LRR [sensitive, ls]	343	366	0.31
LRR [sensitive, ls]	343	366	7.8
LRR [sensitive, ls]	367	390	9.1e-05
LRR [sensitive, ls]	367	390	0.0023
LRR [sensitive, ls]	391	414	0.13
LRR [sensitive, ls]	391	414	3.4
LRR [sensitive, ls]	415	435	0.0095
LRR [sensitive, ls]	415	435	0.24
LRR [sensitive, ls]	507	530	0.00048
LRR [sensitive, ls]	507	530	0.012
LRR [sensitive, ls]	531	554	6.3e-05
LRR [sensitive, ls]	531	554	0.0016
LRR [sensitive, ls]	555	578	0.0037
LRR [sensitive, ls]	555	578	0.096
LRR [sensitive, ls]	579	602	0.94
LRR [sensitive, ls]	579	602	24

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	1	488	7e-31
Xa21 [O. sativa]	5	434	2e-37
FLS2 [A.thaliana]	10	599	3e-61
FLS2 [A.thaliana]	10	432	1e-47
CLV2 [A. thaliana]	12	615	5e-46
Cf-9 [L. pimpinellifolium]	13	599	4e-35
Cf-9 [L. pimpinellifolium]	22	620	2e-48
FLS2 [A.thaliana]	22	998	1e-107
Cf-9 [L. pimpinellifolium]	44	595	2e-38
CLV2 [A. thaliana]	69	571	2e-41
Xa21 [O. sativa]	105	815	2e-74
FLS2 [A.thaliana]	130	595	7e-50
FLS2 [A.thaliana]	171	595	5e-46
Xa21 [O. sativa]	171	597	5e-45
FLS2 [A.thaliana]	237	646	5e-38
FLS2 [A.thaliana]	265	597	1e-32
Xa21 [O. sativa]	273	633	1e-35
Xa21 [O. sativa]	318	561	1e-20
Rpg1 [Hordeum vulgare]	713	1013	3e-31
Rpg1 [Hordeum vulgare]	715	997	3e-38
Pto [L. esculentum]	716	997	4e-42

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	646	668	out -> in

Report for 3127.m00130

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)