Report for 3175.m00178

 > 3175.m00178, length: 1056, copies: 1 

MAITRLLLQLLALPSTVIFLFLAPASRSIDAGDDLHALLSFRSHIAKDHSDALSSWSVVSNGTSDGTNGFCSWRG

VTCSSGARHRRVVSLRVQGLGLVGTISPLVGNLTGLRELDLSDNKLEGEIPPSLARCLALQRLNLSVNFLSGVIP

PSIGQLSKLEVLNIRHNNISGYVPSTFANLTALTMFSIADNYVHGQIPSWLGNLTALESFNIAGNMMRGSVPEAI

SQLTNLEALTISGNGLEGEIPASLFNLSSLKVFNLGSNIISGSLPTDIGLTLPNLRYFIAFYNRLEGQIPASFSN

ISVLEKFILHRNRFRGRIPPNSGINGQLTVFEVGNNELQATEPRDWEFLTSLANCSNLIYINLQLNNLSGILPNT

IANLSLELQSIRLGGNQISGILPKGIGRYAKLTSLEFADNLFNGTIPSDIGKLTNLHELLLFSNGFQGEIPSSIG

NMTQLNQLLLSGNYLEGRIPATIGNLSKLTSMDLSSNLLSGQIPEEIIRISSLTEALNLSNNALSGPISPYIGNL

VNVGIIDLSSNKLSGQIPSTLGNCLALQFLYLQANLLHGLIPKELNKLRGLEVLDLSNNKFSGPIPEFLESFQLL

KNLNLSFNNLSGMVPDKGIFSNASAVSLVSNDMLCGGPMFFHFPPCPFQSSDKPAHRSVVHILIFLIVGAFVFVI

VCIATCYCIKRLREKSSKVNQDQGSKFIDEMYQRISYNELNVATGSFSAENLIGRGSFGSVYRGNLTCGSNVITV

AVKVLDLHQTRAARSFMSECNALKRIRHRNLVRIITVCDSLDNNGDEFKALVLEFISNGNLDTWLHPSTENTSYI

PGKLSLMQRLNIALDVAEALEYLHHHISPSIAHCDIKPSNVLLDKDMTAHIGDFSLARIMSAEAEGQCLGESSSV

GIKGTIGYLAPEYGMGTEISREGDIYSYGVLLLEMLTGRRPTDTMFHDDMSLPKYVEMAYPDNLLEIMDNAIPQD

GNSQDIVDWFIAPISRIGLACCRDSASQRMRMNEVVKELSGIKESEMCGMINTASLYITWQQERKDALSMHASNS

KGFHGV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	110	133	0.008
LRR [Pfam ls]	134	157	0.66
LRR [Pfam ls]	158	181	0.0024
LRR [Pfam ls]	230	253	0.05
LRR [Pfam ls]	254	278	5.1
LRR [Pfam ls]	357	380	1.1
LRR [Pfam ls]	406	429	0.31
LRR [Pfam ls]	430	453	0.38
LRR [Pfam ls]	454	477	0.52
LRR [Pfam ls]	478	502	1.5
LRR [Pfam ls]	527	550	4.5
LRR [Pfam ls]	551	574	3.9
LRR [Pfam ls]	575	598	0.0042
LRR [Pfam ls]	599	624	5.5
Ser/Thr pkinase [Pfam fs]	722	943	1.5e-47
Ser/Thr pkinase [Pfam ls]	722	985	3.4e-42

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	86	109	1.4
LRR [sensitive, ls]	86	109	33
LRR [sensitive, ls]	110	133	0.00034
LRR [sensitive, ls]	110	133	0.008
LRR [sensitive, ls]	134	157	0.028
LRR [sensitive, ls]	134	157	0.66
LRR [sensitive, ls]	158	181	0.0001
LRR [sensitive, ls]	158	181	0.0024
LRR [sensitive, ls]	182	205	1
LRR [sensitive, ls]	182	205	23
LRR [sensitive, ls]	206	229	0.43
LRR [sensitive, ls]	206	229	10
LRR [sensitive, ls]	230	253	0.0021
LRR [sensitive, ls]	230	253	0.05
LRR [sensitive, ls]	254	278	0.22
LRR [sensitive, ls]	254	278	5.1
LRR [sensitive, ls]	279	302	0.38
LRR [sensitive, ls]	279	302	8.9
LRR [sensitive, ls]	303	323	3.1
LRR [sensitive, ls]	303	323	73
LRR [sensitive, ls]	327	350	0.51
LRR [sensitive, ls]	327	350	12
LRR [sensitive, ls]	357	380	0.046
LRR [sensitive, ls]	357	380	1.1
LRR [sensitive, ls]	382	405	0.4
LRR [sensitive, ls]	382	405	9.3
LRR [sensitive, ls]	406	429	0.013
LRR [sensitive, ls]	406	429	0.31
LRR [sensitive, ls]	430	453	0.016
LRR [sensitive, ls]	430	453	0.38
LRR [sensitive, ls]	454	477	0.022
LRR [sensitive, ls]	454	477	0.52
LRR [sensitive, ls]	478	502	0.064
LRR [sensitive, ls]	478	502	1.5
LRR [sensitive, ls]	503	526	0.43
LRR [sensitive, ls]	503	526	10
LRR [sensitive, ls]	527	550	0.19
LRR [sensitive, ls]	527	550	4.5
LRR [sensitive, ls]	551	574	0.17
LRR [sensitive, ls]	551	574	3.9
LRR [sensitive, ls]	575	598	0.00018
LRR [sensitive, ls]	575	598	0.0042
LRR [sensitive, ls]	599	624	0.24
LRR [sensitive, ls]	599	624	5.5

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	10	836	1e-165
FLS2 [A.thaliana]	11	615	4e-90
CLV2 [A. thaliana]	34	614	7e-55
Cf-9 [L. pimpinellifolium]	85	639	3e-54
CLV2 [A. thaliana]	85	688	7e-45
FLS2 [A.thaliana]	87	1018	1e-125
Cf-9 [L. pimpinellifolium]	114	617	1e-52
CLV2 [A. thaliana]	182	631	2e-51
FLS2 [A.thaliana]	345	632	4e-36
Rpg1 [Hordeum vulgare]	708	1017	3e-30
Pto [L. esculentum]	709	939	8e-25
Rpg1 [Hordeum vulgare]	715	1017	6e-21

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	662	684	out -> in

Report for 3175.m00178

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)