Report for 3181.m00131

 > 3181.m00131, length: 1098, copies: 2 

MAHAVHRHGGISLRSQQMALLHWKSTLQSTGPQMRSSWQASTSPCNWTGITCRAAHQAMSWVITNISLPDAGIHG

QLGELNFSSLPFLTYIDLSSNSVYGPIPSSISSLSALTYLDLQLNQLTGRMPDEISELQRLTMLDLSYNNLTGHI

PASVGNLTMITELSIHRNMVSGPIPKEIGMLANLQLLQLSNNTLSGEIPTTLANLTNLDTFYLDGNELSGPVPPK

LCKLTNLQYLALGDNKLTGEIPTCIGNLTKMIKLYLFRNQIIGSIPPEIGNLAMLTDLVLNENKLKGSLPTELGN

LTMLNNLFLHENQITGSIPPGLGIISNLQNLILHSNQISGSIPGTLANLTKLIALDLSKNQINGSIPQEFGNLVN

LQLLSLEENQISGSIPKSLGNFQNMQNLNFRSNQLSNSLPQEFGNITNMVELDLASNSLSGQLPANICAGTSLKL

LFLSLNMFNGPVPRSLKTCTSLVRLFLDGNQLTGDISKHFGVYPKLKKMSLMSNRLSGQISPKWGACPELAILNI

AENMITGTIPPALSKLPNLVELKLSSNHVNGVIPPEIGNLINLYSLNLSFNKLSGSIPSQLGNLRDLEYLDVSRN

SLSGPIPEELGRCTKLQLLRINNNHFSGNLPATIGNLASIQIMLDVSNNKLDGLLPQDFGRMQMLVFLNLSHNQF

TGRIPTSFASMVSLSTLDASYNNLEGPLPAGRLFQNASASWFLNNKGLCGNLSGLPSCYSAPGHNKRKLFRFLLP

VVLVLGFAILATVVLGTVFIHNKRKPQESTTAKGRDMFSVWNFDGRLAFEDIVRATEDFDDKYIIGAGGYGKVYR

AQLQDGQVVAVKKLHTTEEGLGDEKRFSCEMEILTQIRQRSIVKLYGFCSHPEYRFLVYEYIEQGSLHMTLADDE

LAKALDWQKRNILIKDVAQALCYLHHDCNPPIIHRDITSNNILLDTTLKAYVSDFGTARILRPDSSNWSALAGTY

GYIAPELSYTSLVTEKCDVYSFGMVMLEVVIGKHPRDLLQHLTSSRDHNITIKEILDSRPLAPTTTEEENIVSLI

KVVFSCLKASPQARPTMQEVYQTLIDYQTSSFLSKNCSRVILDELWDS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	87	110	0.75
LRR [Pfam ls]	111	134	4
LRR [Pfam ls]	135	158	0.002
LRR [Pfam ls]	183	206	0.0082
LRR [Pfam ls]	207	230	2.5
LRR [Pfam ls]	231	254	0.1
LRR [Pfam ls]	255	278	5.1
LRR [Pfam ls]	279	302	3.6
LRR [Pfam ls]	327	350	0.016
LRR [Pfam ls]	351	374	0.08
LRR [Pfam ls]	375	398	0.025
LRR [Pfam ls]	399	422	1.7
LRR [Pfam ls]	471	494	0.59
LRR [Pfam ls]	519	542	0.076
LRR [Pfam ls]	543	566	0.42
LRR [Pfam ls]	567	590	0.0065
LRR [Pfam ls]	591	614	0.22
LRR [Pfam ls]	615	638	0.65
LRR [Pfam ls]	664	687	0.45
Ser/Thr pkinase [Pfam fs]	809	1074	3.8e-42
Ser/Thr pkinase [Pfam ls]	809	1075	7.3e-42

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	87	110	0.032
LRR [sensitive, ls]	87	110	0.75
LRR [sensitive, ls]	111	134	0.17
LRR [sensitive, ls]	111	134	4
LRR [sensitive, ls]	135	158	8.6e-05
LRR [sensitive, ls]	135	158	0.002
LRR [sensitive, ls]	159	182	3.3
LRR [sensitive, ls]	159	182	77
LRR [sensitive, ls]	183	206	0.00035
LRR [sensitive, ls]	183	206	0.0082
LRR [sensitive, ls]	207	230	0.11
LRR [sensitive, ls]	207	230	2.5
LRR [sensitive, ls]	231	254	0.0045
LRR [sensitive, ls]	231	254	0.1
LRR [sensitive, ls]	255	278	0.22
LRR [sensitive, ls]	255	278	5.1
LRR [sensitive, ls]	279	302	0.15
LRR [sensitive, ls]	279	302	3.6
LRR [sensitive, ls]	303	323	0.29
LRR [sensitive, ls]	303	323	6.7
LRR [sensitive, ls]	327	350	0.00068
LRR [sensitive, ls]	327	350	0.016
LRR [sensitive, ls]	351	374	0.0034
LRR [sensitive, ls]	351	374	0.08
LRR [sensitive, ls]	375	398	0.0011
LRR [sensitive, ls]	375	398	0.025
LRR [sensitive, ls]	399	422	0.072
LRR [sensitive, ls]	399	422	1.7
LRR [sensitive, ls]	423	446	0.37
LRR [sensitive, ls]	423	446	8.7
LRR [sensitive, ls]	447	470	0.49
LRR [sensitive, ls]	447	470	11
LRR [sensitive, ls]	471	494	0.025
LRR [sensitive, ls]	471	494	0.59
LRR [sensitive, ls]	495	518	1.6
LRR [sensitive, ls]	495	518	38
LRR [sensitive, ls]	519	542	0.0033
LRR [sensitive, ls]	519	542	0.076
LRR [sensitive, ls]	543	566	0.018
LRR [sensitive, ls]	543	566	0.42
LRR [sensitive, ls]	567	590	0.00028
LRR [sensitive, ls]	567	590	0.0065
LRR [sensitive, ls]	591	614	0.0096
LRR [sensitive, ls]	591	614	0.22
LRR [sensitive, ls]	615	638	0.028
LRR [sensitive, ls]	615	638	0.65
LRR [sensitive, ls]	664	687	0.019
LRR [sensitive, ls]	664	687	0.45
LRR [sensitive, ls]	688	713	0.4
LRR [sensitive, ls]	688	713	9.4

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	9	608	6e-85
FLS2 [A.thaliana]	10	1075	1e-157
CLV2 [A. thaliana]	36	628	3e-55
Cf-9 [L. pimpinellifolium]	37	725	6e-73
CLV2 [A. thaliana]	88	542	1e-50
Xa21 [O. sativa]	88	362	6e-35
CLV2 [A. thaliana]	122	660	4e-58
Xa21 [O. sativa]	187	892	6e-95
CLV2 [A. thaliana]	213	738	4e-61
CLV2 [A. thaliana]	306	708	6e-51
Xa21 [O. sativa]	495	704	8e-32
CLV2 [A. thaliana]	544	705	2e-16
Pto [L. esculentum]	796	1070	6e-36
Rpg1 [Hordeum vulgare]	798	1074	9e-28
Rpg1 [Hordeum vulgare]	806	1074	6e-25

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	748	770	out -> in

Report for 3181.m00131

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)