Report for 3181.m00133

 > 3181.m00133, length: 628, copies: 2 

MTMFHNRLTGSLPREFENLTGIPDLWLDNNQFSGHLPAYVCMGGRLKTFMVSVNTFDGPIPRSLKTCTSLVRIAV

HKNQLTGDISEHFGVYPHLKTVSLAYNRFSGQITPNWVASPQLEEMYFQGNMITGVLPPALSKLSNLGVLRLDLN

NISGEIPAEFGNLKSLYKLNLSFNQLSGSLPAQLGKLSNLGYLDVSRNNLSGPIPDELGDCIRLESLKINNNNIH

GNLPGTIGNLKGLQIILDASNNKLDGLLPQQLGTLQMLEILNLSHNQFRGSLPSSIASMLSLTVLDVSYNNLEGP

LPAGHLLQNASISWFIHNKVIASGHHKPKLLSLLLPIVLVVNFDGRLAFEDIIRATENFNDKHIVGIGGSGKVYK

ARLQDGNVVIVEKLHPVEEESNVKLYGFCFHPNYNFLVYDYIQRGSLYMTLKNEELAKELDWSKRVTLVKDVAQA

LSYLHHDCSPPIIHRDITSNNILLDTAFKAYVSDFGTARILKPDSSNWSALAGTYGYIAPELSFTCVVTEKCDVY

SFGVVVLEVVMGKHPMELLQTLLSSEQQHTLVKEILDERPTAPTTAEEESIEILIKVAISCLEASPHARPTMMEA

YQTLIQQHSSSSCPIRFNEVTLEQLRNT

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	117	140	0.23
LRR [Pfam ls]	141	164	0.25
LRR [Pfam ls]	165	188	0.054
LRR [Pfam ls]	189	212	0.79
LRR [Pfam ls]	213	236	0.42
LRR [Pfam ls]	262	285	0.64
LRR [Pfam ls]	286	308	1
Ser/Thr pkinase [Pfam fs]	359	386	0.0032
Ser/Thr pkinase [Pfam ls]	359	606	3.7e-34
Ser/Thr pkinase [Pfam fs]	398	604	4.6e-32

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	69	92	0.92
LRR [sensitive, ls]	69	92	21
LRR [sensitive, ls]	93	116	1.6
LRR [sensitive, ls]	93	116	37
LRR [sensitive, ls]	117	140	0.0098
LRR [sensitive, ls]	117	140	0.23
LRR [sensitive, ls]	141	164	0.011
LRR [sensitive, ls]	141	164	0.25
LRR [sensitive, ls]	165	188	0.0023
LRR [sensitive, ls]	165	188	0.054
LRR [sensitive, ls]	189	212	0.034
LRR [sensitive, ls]	189	212	0.79
LRR [sensitive, ls]	213	236	0.018
LRR [sensitive, ls]	213	236	0.42
LRR [sensitive, ls]	262	285	0.027
LRR [sensitive, ls]	262	285	0.64
LRR [sensitive, ls]	286	308	0.045
LRR [sensitive, ls]	286	308	1

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	1	278	2e-28
CLV2 [A. thaliana]	1	333	2e-30
CLV2 [A. thaliana]	1	299	2e-25
FLS2 [A.thaliana]	1	606	2e-66
FLS2 [A.thaliana]	1	302	3e-42
FLS2 [A.thaliana]	1	304	2e-40
FLS2 [A.thaliana]	1	303	3e-36
Xa21 [O. sativa]	1	302	9e-39
CLV2 [A. thaliana]	5	258	2e-14
Xa21 [O. sativa]	5	133	1e-10
Cf-9 [L. pimpinellifolium]	6	374	6e-24
Cf-9 [L. pimpinellifolium]	6	301	1e-23
CLV2 [A. thaliana]	6	306	5e-33
FLS2 [A.thaliana]	6	302	3e-45
FLS2 [A.thaliana]	6	302	7e-42
Xa21 [O. sativa]	6	324	2e-37
Xa21 [O. sativa]	6	422	1e-33
Xa21 [O. sativa]	6	308	5e-28
Cf-9 [L. pimpinellifolium]	12	325	2e-26
CLV2 [A. thaliana]	27	315	1e-29
Xa21 [O. sativa]	58	302	1e-23
FLS2 [A.thaliana]	66	301	1e-28
Xa21 [O. sativa]	70	292	4e-28
Xa21 [O. sativa]	91	302	7e-30
FLS2 [A.thaliana]	93	323	5e-29
Pto [L. esculentum]	346	597	1e-31
Rpg1 [Hordeum vulgare]	348	604	6e-25
Rpg1 [Hordeum vulgare]	356	604	5e-19

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 3181.m00133

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)