Report for 33.m00106

 > 33.m00106, length: 1172, copies: 1 

MAGVVFLVLFVAAAAMPASVTAATSQTDALLAWKASLLLGDAAALSGWTRAAPVCTWRGVACDAAGRVTSLRLRD

AGLSGGLDTLDFAALPALTELDLNRNNFTGPIPASISRLRSLSLLDLGSNWLDGSIPPQLGDLSGLVELRLYNNN

LVGAIPHQLSRLPNIVHFDLGANYLTDHDFRKFSPMPTVTFMSLYLNSFNGSFPEFVLRSGSITYLDLSQNALFG

PIPDMLPNLRFLNLSFNAFSGPIPASLGRLTKLQDLRMAGNNLTGGVPEFLGSMAQLRILELGDNQLGGPIPSVL

GQLQMLQRLDIKNASLVSTLPPQLGNLNNLAYLDLSLNQFSGGLPPTFAGMRAMQEFGLSTTNVTGEIPPALFTS

WPELISFEVQNNSFTGKIPSELGKARKLEILYLFLNNLNGSIPAELGELENLVELDLSVNSLTGPIPSSLGNLKQ

LIKLALFFNNLTGVIPPEIGNMTALQSFDVNTNILHGELPATITALKNLQYLAVFDNFMSGTIPPDLGKGIALQH

VSFSNNSFSGELPRNLCDGFALEHFTVNYNNFTGTLPPCLKNCTGLFRVRLEENHFTGDISEAFGVHPSLEYLDI

SGNKLTGELSSDWGQCTNLTLLSMDGNRISGRIPEAFGSMTRLQILSLAGNNLTGGIPLDLGHLNLLFNLNLSHN

SFSGPIPTSLGNNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGKIPRELGNLVQLQTLLDLSSNFL

SGWIPQAAFCKLLSLQILILSNNQLTGKLPDCLWYLQNLQFLDLSNNAFSGEIPAAKASYSCSLISIHLSSNDFT

GVFPSALEGCKKLINLDIGNNNFFGDIPIWIGKGLPSLKILSLKSNNFSGEIPSELSQLSQLQLLDMTNNGLTGL

IPRSFGKLTSMKNPKLISSRELLQWSFNHDRINTIWKGKEQIFEIKTYAIDIQLVTGISLSGNSLSQCIPDELMN

LQGLQFLNLSRNYLSRSIPENIGSLKNLESLDLSSNELSGAIPPSLAGISTLSSLNLSNNHLSGKISTGNQLQTL

TDPSIYSNNSGLCGLPLNISCTNYALASDERYCRTCEDQYLSYFVMAGVVFGSWLWFGMLFSIGNLRYAVFCFVD

DIQRKVMQKVSLKREGKGDLSRVEDDGHLNFGPRNSGAGEFSGFGGA

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	92	115	0.054
LRR [Pfam ls]	116	139	0.33
LRR [Pfam ls]	140	163	0.092
LRR [Pfam ls]	233	256	0.0094
LRR [Pfam ls]	257	280	1.1
LRR [Pfam ls]	281	304	0.049
LRR [Pfam ls]	329	352	0.057
LRR [Pfam ls]	402	425	4.7
LRR [Pfam ls]	426	449	0.0032
LRR [Pfam ls]	450	473	2.3
LRR [Pfam ls]	546	569	4.2
LRR [Pfam ls]	594	617	0.0056
LRR [Pfam ls]	618	641	0.0081
LRR [Pfam ls]	642	665	0.0082
LRR [Pfam ls]	666	689	5.4
LRR [Pfam ls]	690	713	0.12
LRR [Pfam ls]	714	737	0.032
LRR [Pfam ls]	764	787	0.08
LRR [Pfam ls]	788	809	0.39
LRR [Pfam ls]	813	836	0.46
LRR [Pfam ls]	837	861	5.4
LRR [Pfam ls]	862	885	0.23
LRR [Pfam fs]	886	909	2.2e-05
LRR [Pfam ls]	886	909	0.00036
LRR [Pfam ls]	978	1001	0.043
LRR [Pfam ls]	1002	1025	0.0045
LRR [Pfam ls]	1026	1048	4

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	67	91	0.68
LRR [sensitive, ls]	67	91	16
LRR [sensitive, ls]	92	115	0.0023
LRR [sensitive, ls]	92	115	0.054
LRR [sensitive, ls]	116	139	0.014
LRR [sensitive, ls]	116	139	0.33
LRR [sensitive, ls]	140	163	0.004
LRR [sensitive, ls]	140	163	0.092
LRR [sensitive, ls]	164	187	0.81
LRR [sensitive, ls]	164	187	19
LRR [sensitive, ls]	212	232	0.28
LRR [sensitive, ls]	212	232	6.6
LRR [sensitive, ls]	233	256	0.0004
LRR [sensitive, ls]	233	256	0.0094
LRR [sensitive, ls]	257	280	0.049
LRR [sensitive, ls]	257	280	1.1
LRR [sensitive, ls]	281	304	0.0021
LRR [sensitive, ls]	281	304	0.049
LRR [sensitive, ls]	305	328	0.4
LRR [sensitive, ls]	305	328	9.3
LRR [sensitive, ls]	329	352	0.0024
LRR [sensitive, ls]	329	352	0.057
LRR [sensitive, ls]	353	377	1.1
LRR [sensitive, ls]	353	377	26
LRR [sensitive, ls]	378	401	0.6
LRR [sensitive, ls]	378	401	14
LRR [sensitive, ls]	402	425	0.2
LRR [sensitive, ls]	402	425	4.7
LRR [sensitive, ls]	426	449	0.00014
LRR [sensitive, ls]	426	449	0.0032
LRR [sensitive, ls]	450	473	0.1
LRR [sensitive, ls]	450	473	2.3
LRR [sensitive, ls]	474	497	2.7
LRR [sensitive, ls]	474	497	62
LRR [sensitive, ls]	498	518	0.76
LRR [sensitive, ls]	498	518	18
LRR [sensitive, ls]	522	542	0.48
LRR [sensitive, ls]	522	542	11
LRR [sensitive, ls]	546	569	0.18
LRR [sensitive, ls]	546	569	4.2
LRR [sensitive, ls]	570	593	0.85
LRR [sensitive, ls]	570	593	20
LRR [sensitive, ls]	594	617	0.00024
LRR [sensitive, ls]	594	617	0.0056
LRR [sensitive, ls]	618	641	0.00035
LRR [sensitive, ls]	618	641	0.0081
LRR [sensitive, ls]	642	665	0.00035
LRR [sensitive, ls]	642	665	0.0082
LRR [sensitive, ls]	666	689	0.23
LRR [sensitive, ls]	666	689	5.4
LRR [sensitive, ls]	690	713	0.0053
LRR [sensitive, ls]	690	713	0.12
LRR [sensitive, ls]	714	737	0.0014
LRR [sensitive, ls]	714	737	0.032
LRR [sensitive, ls]	764	787	0.0034
LRR [sensitive, ls]	764	787	0.08
LRR [sensitive, ls]	788	809	0.017
LRR [sensitive, ls]	788	809	0.39
LRR [sensitive, ls]	813	836	0.02
LRR [sensitive, ls]	813	836	0.46
LRR [sensitive, ls]	837	861	0.23
LRR [sensitive, ls]	837	861	5.4
LRR [sensitive, ls]	862	885	0.0097
LRR [sensitive, ls]	862	885	0.23
LRR [sensitive, ls]	886	909	1.5e-05
LRR [sensitive, ls]	886	909	0.00036
LRR [sensitive, ls]	954	977	0.59
LRR [sensitive, ls]	954	977	14
LRR [sensitive, ls]	978	1001	0.0018
LRR [sensitive, ls]	978	1001	0.043
LRR [sensitive, ls]	1002	1025	0.00019
LRR [sensitive, ls]	1002	1025	0.0045
LRR [sensitive, ls]	1026	1048	0.17
LRR [sensitive, ls]	1026	1048	4

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	4	562	5e-73
CLV2 [A. thaliana]	5	715	1e-64
FLS2 [A.thaliana]	26	804	1e-107
Cf-9 [L. pimpinellifolium]	48	807	6e-64
FLS2 [A.thaliana]	66	497	8e-47
Cf-9 [L. pimpinellifolium]	67	535	3e-42
FLS2 [A.thaliana]	85	777	9e-80
Xa21 [O. sativa]	213	706	5e-74
FLS2 [A.thaliana]	232	1064	1e-109
Xa21 [O. sativa]	308	835	1e-71
CLV2 [A. thaliana]	309	856	1e-53
Cf-9 [L. pimpinellifolium]	378	1071	6e-72
Xa21 [O. sativa]	406	1064	3e-64
CLV2 [A. thaliana]	427	1063	1e-64
Xa21 [O. sativa]	573	1059	1e-54
Xa21 [O. sativa]	642	1041	5e-44
CLV2 [A. thaliana]	646	1070	7e-39
Xa21 [O. sativa]	647	1059	3e-40

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	2	24	in -> out
putative TM domain	1102	1124	out -> in

Report for 33.m00106

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)