Report for 3329.m00112

 > 3329.m00112, length: 710, copies: 2 

MPMAALRLLLLALAVACCAVAEPPQQERSALRAFLAGTPHERALAWNASTPACAWVGVTCDAANATVVALRLPGV

GLIGRVPQGTLGALRGLRVLSLRSNRLFGDVPGDLFSLPDLRSLFLQGNLFSGSVPPDVAKLTALQHLALSHNNL

TGAIPFALNGLANLRSLRLDGNRFSGSLPSLTLPLLEDFNVSYNQLNGSIPASLARFPPESFAGNLQLCGKPLSR

PCEPFFPSPAGAPTPTDGRGSGGGSVPVSEKKKKKLSGAAVAAIAVGGGAAALLALVLLVVCTAASRRRAANGEV

GKTAAARGLTPPSTASGELGEVTSSTSKEIALAAAAATAERSRLVFVGKGAAYSFDLEELLRASAEVLGKGSVGT

SYKAVLEEGATVVVKRLKEVAASRREFSAHLDSLGKVDHRNLLPVRGYYFSKDEKLLVCDYLPAGSLSATLHAKA

IGAHLHTRHTDYEYDTRNANLIKRVSSVISISIGDAVAISTTNSELTSGSRGTGRRTMDWDARMRAALSAARGVA

HLHAAHSLAHGNLKSSNLLLRPDPDATALSDYCLHQLFAPLSARPNAGGYRAPELVDARRPTFKSDVYSLGVLFL

ELLTGKSPGNASVDGDGAVDLPRWVQSVVREEWTAEVFDVELVRLGGSAEEEMVALLQVAMACVATAPDARPDTA

DVVKMIEEIGSGHGRTTTEESEDRSRGTPPAGTTP

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	91	114	1.1
LRR [Pfam ls]	115	138	0.17
LRR [Pfam ls]	139	162	0.18
LRR [Pfam ls]	163	184	0.58
Ser/Thr pkinase [Pfam fs]	362	545	2.8e-07
Ser/Thr pkinase [Pfam ls]	362	681	2e-11
Ser/Thr pkinase [Pfam fs]	574	608	1.9e-07

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	91	114	0.042
LRR [sensitive, ls]	91	114	1.1
LRR [sensitive, ls]	115	138	0.0063
LRR [sensitive, ls]	115	138	0.17
LRR [sensitive, ls]	139	162	0.0067
LRR [sensitive, ls]	139	162	0.18
LRR [sensitive, ls]	163	184	0.022
LRR [sensitive, ls]	163	184	0.58
LRR [sensitive, ls]	185	208	0.41
LRR [sensitive, ls]	185	208	11

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	1	201	5e-16
CLV2 [A. thaliana]	24	208	8e-12
Cf-9 [L. pimpinellifolium]	31	201	2e-11
Xa21 [O. sativa]	45	201	2e-19
Xa21 [O. sativa]	55	208	2e-13
CLV2 [A. thaliana]	67	205	3e-14
CLV2 [A. thaliana]	69	207	3e-11
FLS2 [A.thaliana]	70	206	9e-13
FLS2 [A.thaliana]	74	200	7e-13
FLS2 [A.thaliana]	77	204	5e-12
FLS2 [A.thaliana]	77	206	8e-12
FLS2 [A.thaliana]	77	204	1e-11
Xa21 [O. sativa]	78	476	2e-19
FLS2 [A.thaliana]	79	699	5e-32
FLS2 [A.thaliana]	86	204	2e-15
Cf-9 [L. pimpinellifolium]	121	227	4e-11
Rpg1 [Hordeum vulgare]	340	685	2e-15
Pto [L. esculentum]	352	682	2e-17

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	264	286	out -> in

Report for 3329.m00112

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)