Report for 3355.m00130

 > 3355.m00130, length: 1251, copies: 1 

MAMEYLHHEHYEIVQHCDQKPSNVLFDEETTVHVADFGIAKLLLGDDTSKITNHGKHAHQNRGKLKLRLRKSSLE

SDLRIDRLFVGEVTIRQWVNQAFSAKLVHVLDDKLQLDESSIEDLNHLLLPIFESCRQSLVGVDGPRWFDTANEG

CLPAVLHTAELLIISLTVTALAAGASSSPSPSINSSSGGGAAADLAALLAFKAQLADPLGVLAGSWTTNVSFCNW

VGVSCSRRRRPERVTGLSLPDAPLGGELTAHLGNLSFLYTLDLTNTSLVGPVPADLGRLRRLRSLLLGDNLLSAA

IPPAIANLTMLELLHLGNNNLSGEIPPDLLHGMRRLSRIALHMNQLTGDLPPLLFNGTPSLTFVNLGNNSLTGGV

PHGVASSPSSLPMLEYLNLRGNRLAGAVPPAVYNMSRLRGLVLSHNNLTGWIPTTSNGSFHLPMLRTFSISSNGF

AGRIPAGLAACRYLQTLSISSNSFVDVVPAWLAQLPYLTELFLGGNQLTGSIPPGLGNLTGVTSLDLSFCNLTGE

IPSELGLMRSLSTLRLTYNQLTGPIPTSLGNLSQLSFLDLQMNQLTGAVPATLGNIPALNWLTLSLNNLEGNLGF

LSSLSNCRQIWIITLDSNSFTGDLPDHTGNLSAQLSIFSASENKLTGGLPSSLSNLSSLEQLQLPGNQLTGPIPE

SITMMPNLVRLDVSSNDISGPIPTQIGMLSSLQRLDLQRNRLFGSIPDSIGNLSELEHIMLSHNQLNSTIPASFF

NLGKLVRLNLSHNSFTGALPNDLSRLKQGDTIDLSSNSLLGSIPESFGQIRMLTYLNLSHNSFGDSIPYSFQELA

NLATLDLSSNNLSGTIPKFLANFTYLTALNLSFNRLEGQIPDGGVFSNITLQSLIGNAALCGAPRLGFSPCLQKS

HSNSRHFLRFLLPVVTVAFGCMVICIFLMIRRKSKNKKEDSSHTPGDDMNHLIVTYHELARATDKFSDDNLLGSG

SFGKVFKGQLSSGLVVAIKVLDMHLEEVAIRSFDAECRVLRMARHRNLIKVLNTCSNMEFRALVLHYMPNGSLDM

LLHSQGTSSLGLLKRLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDEEMTAHVADFGIAKLLLGDDTSKIT

ASMPGTFGYMAPEYGSLGKASRNSDVFSFGIMLLEVFTGKRPTDRLFVGEVTIRQWVNQAFPAKLVHVLDDKLQL

DESSIQDLNHLLLPIFEVGLLCSSDLPDQRMSMAGVVVTLKKIRKDYEEKN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
Ser/Thr pkinase [Pfam fs]	2	43	3e-08
LRR [Pfam ls]	286	309	0.15
LRR [Pfam ls]	310	334	0.0017
LRR [Pfam ls]	360	384	3.7
LRR [Pfam ls]	388	411	6.4
LRR [Pfam ls]	463	486	2.8
LRR [Pfam ls]	487	510	0.0069
LRR [Pfam ls]	511	534	0.12
LRR [Pfam ls]	535	558	0.068
LRR [Pfam ls]	634	657	8.6
LRR [Pfam ls]	658	681	1.6
LRR [Pfam ls]	682	705	7.5
LRR [Pfam ls]	706	729	0.042
LRR [Pfam ls]	730	753	0.24
LRR [Pfam ls]	754	777	0.0091
LRR [Pfam ls]	802	825	0.39
LRR [Pfam ls]	826	849	0.0058
LRR [Pfam ls]	850	872	6.2
Ser/Thr pkinase [Pfam fs]	966	1170	4.3e-47
Ser/Thr pkinase [Pfam ls]	966	1213	4.1e-45

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	262	285	0.84
LRR [sensitive, ls]	262	285	17
LRR [sensitive, ls]	286	309	0.0076
LRR [sensitive, ls]	286	309	0.15
LRR [sensitive, ls]	310	334	8.7e-05
LRR [sensitive, ls]	310	334	0.0017
LRR [sensitive, ls]	335	359	2.3
LRR [sensitive, ls]	335	359	45
LRR [sensitive, ls]	360	384	0.19
LRR [sensitive, ls]	360	384	3.7
LRR [sensitive, ls]	388	411	0.32
LRR [sensitive, ls]	388	411	6.4
LRR [sensitive, ls]	412	438	0.69
LRR [sensitive, ls]	412	438	14
LRR [sensitive, ls]	439	462	3.3
LRR [sensitive, ls]	439	462	65
LRR [sensitive, ls]	463	486	0.14
LRR [sensitive, ls]	463	486	2.8
LRR [sensitive, ls]	487	510	0.00035
LRR [sensitive, ls]	487	510	0.0069
LRR [sensitive, ls]	511	534	0.006
LRR [sensitive, ls]	511	534	0.12
LRR [sensitive, ls]	535	558	0.0035
LRR [sensitive, ls]	535	558	0.068
LRR [sensitive, ls]	559	582	1.5
LRR [sensitive, ls]	559	582	29
LRR [sensitive, ls]	583	605	4.3
LRR [sensitive, ls]	583	605	84
LRR [sensitive, ls]	609	632	1.7
LRR [sensitive, ls]	609	632	34
LRR [sensitive, ls]	634	657	0.43
LRR [sensitive, ls]	634	657	8.6
LRR [sensitive, ls]	658	681	0.082
LRR [sensitive, ls]	658	681	1.6
LRR [sensitive, ls]	682	705	0.38
LRR [sensitive, ls]	682	705	7.5
LRR [sensitive, ls]	706	729	0.0021
LRR [sensitive, ls]	706	729	0.042
LRR [sensitive, ls]	730	753	0.012
LRR [sensitive, ls]	730	753	0.24
LRR [sensitive, ls]	754	777	0.00046
LRR [sensitive, ls]	754	777	0.0091
LRR [sensitive, ls]	802	825	0.02
LRR [sensitive, ls]	802	825	0.39
LRR [sensitive, ls]	826	849	0.0003
LRR [sensitive, ls]	826	849	0.0058
LRR [sensitive, ls]	850	872	0.31
LRR [sensitive, ls]	850	872	6.2

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	166	596	3e-30
CLV2 [A. thaliana]	194	886	5e-59
FLS2 [A.thaliana]	194	866	8e-89
Cf-9 [L. pimpinellifolium]	215	889	9e-63
FLS2 [A.thaliana]	241	504	1e-19
FLS2 [A.thaliana]	249	1244	1e-147
Xa21 [O. sativa]	392	1055	1e-117
FLS2 [A.thaliana]	497	879	1e-57
CLV2 [A. thaliana]	508	887	1e-42
Cf-9 [L. pimpinellifolium]	651	899	4e-19
Xa21 [O. sativa]	683	899	4e-29
FLS2 [A.thaliana]	753	867	8e-12
Pto [L. esculentum]	958	1198	3e-28
Rpg1 [Hordeum vulgare]	959	1243	2e-23
Rpg1 [Hordeum vulgare]	963	1165	4e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	908	930	out -> in

Report for 3355.m00130

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)