Report for 3375.m00141

 > 3375.m00141, length: 1066, copies: 2 

MALGFPECISAVVLISLSTMIAASSGLSMSNSSNTDLTALMAFKAQLSDPLGILGRNWTVGTPFCHWVGVSCRRH

RQRVTAVELPDVPLQGELSPHIGNLSFLSVLNLSNTGLMGSVPDDIGRLHRLKILDLGHNDMLGGVPATIGNLTR

LDVLDLEFNSLSGPIPVELRLSHNLRSINIQMNYLTGLIPNGLFNNTPSLKHLIIGNNSLSGPIPSCIGSLPLLE

RLVLQCNNLTGPVPPSIFNMSRLHVIALASNGLTGPIPGNKSFILPILQFFSLDYNYFTGQIPLGLAACRHLKVF

SLLDNLIEGPLPSWLGKLTKLNVISLGENLLVVGPIRDALSNLTMLNFLDLAMCNLTGAIPADLGQIGHLSVLRL

STNQLTGPIPASLGNLSALSVLLLDDNHLDGLLPTTIGNMNSLTELIISENGLQGDLNFLSAVSNCRKLSVLCIN

SNRFTGILPDYLGNLSSTLESFLASRIKLSESIMEMENLHMLDLSGNNLAGSIPSNTAMLKNVVMLFLQNNEFSG

SIIEDIGNLTKLEHLRLSNNQLSSTVPPSLFHLDSLIELDLSRNLFSGALPVDIGHLKQIYKMDLSSNHFLGSLP

DSIGQIQMITYLNLSINSFNDSIPNSFGNLTSLQTLDLSHNNISGTIPKYLSSFTMLASLNLSFNNLHGQIPGGG

VFSNITLQSLVGNSGLCGVVRLGFAPCKTTYPKRNGHMLKFLLPTIIIVVGAVACCLYVMIRKKVKHQKISTGMV

DTVSHQLLSYHELVRATDNFSNDNMLGSGSFGKVFKGQLSSGLVVAIKVIHQHLEHAVRSFNTECRVLRMARHRN

LIKIVNTCSNLDFRALVLPYMPNGSLEALLHSEGRMQLGFLQRLDIMLDVSMAIEYLHHEHCEVILHCDLKPSNV

LFDDDMTAHVSDFGIARLLLGDDSSMISASMPGTVGYIAPEYGALGKASRKSDVFSYGIMLLEVFTGKRPTDAMF

VGELNNRLWVSQAFPAELVHVVDSQLLHDGSSSTTNLHLHGFLVHVFELGLHCSADYPEQRMAMRDVVVTLKTIR

KDYVNWMVLMGSTAQQ

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	102	125	4.4
LRR [Pfam ls]	126	149	0.23
LRR [Pfam ls]	174	198	5.1
LRR [Pfam ls]	199	222	0.13
LRR [Pfam ls]	223	246	3.8
LRR [Pfam ls]	369	392	0.081
LRR [Pfam ls]	443	466	0.38
LRR [Pfam ls]	488	511	0.12
LRR [Pfam ls]	512	535	0.46
LRR [Pfam ls]	536	559	0.0099
LRR [Pfam ls]	560	583	0.07
LRR [Pfam ls]	608	631	0.96
LRR [Pfam fs]	632	655	1.9e-05
LRR [Pfam ls]	632	655	0.00032
Ser/Thr pkinase [Pfam fs]	770	972	1.1e-49
Ser/Thr pkinase [Pfam ls]	770	1018	1.5e-47

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	102	125	0.19
LRR [sensitive, ls]	102	125	4.4
LRR [sensitive, ls]	126	149	0.0098
LRR [sensitive, ls]	126	149	0.23
LRR [sensitive, ls]	150	173	0.32
LRR [sensitive, ls]	150	173	7.5
LRR [sensitive, ls]	174	198	0.22
LRR [sensitive, ls]	174	198	5.1
LRR [sensitive, ls]	199	222	0.0055
LRR [sensitive, ls]	199	222	0.13
LRR [sensitive, ls]	223	246	0.16
LRR [sensitive, ls]	223	246	3.8
LRR [sensitive, ls]	247	266	2.1
LRR [sensitive, ls]	247	266	49
LRR [sensitive, ls]	272	295	2.8
LRR [sensitive, ls]	272	295	65
LRR [sensitive, ls]	296	319	0.67
LRR [sensitive, ls]	296	319	16
LRR [sensitive, ls]	320	344	0.24
LRR [sensitive, ls]	320	344	5.7
LRR [sensitive, ls]	345	368	3.5
LRR [sensitive, ls]	345	368	81
LRR [sensitive, ls]	369	392	0.0035
LRR [sensitive, ls]	369	392	0.081
LRR [sensitive, ls]	393	416	0.35
LRR [sensitive, ls]	393	416	8.1
LRR [sensitive, ls]	417	439	0.28
LRR [sensitive, ls]	417	439	6.6
LRR [sensitive, ls]	443	466	0.016
LRR [sensitive, ls]	443	466	0.38
LRR [sensitive, ls]	488	511	0.005
LRR [sensitive, ls]	488	511	0.12
LRR [sensitive, ls]	512	535	0.02
LRR [sensitive, ls]	512	535	0.46
LRR [sensitive, ls]	536	559	0.00042
LRR [sensitive, ls]	536	559	0.0099
LRR [sensitive, ls]	560	583	0.003
LRR [sensitive, ls]	560	583	0.07
LRR [sensitive, ls]	584	607	1.8
LRR [sensitive, ls]	584	607	41
LRR [sensitive, ls]	608	631	0.041
LRR [sensitive, ls]	608	631	0.96
LRR [sensitive, ls]	632	655	1.4e-05
LRR [sensitive, ls]	632	655	0.00032
LRR [sensitive, ls]	656	678	0.38
LRR [sensitive, ls]	656	678	8.8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	12	858	1e-118
FLS2 [A.thaliana]	26	695	8e-81
CLV2 [A. thaliana]	36	692	5e-57
Cf-9 [L. pimpinellifolium]	57	693	4e-61
FLS2 [A.thaliana]	89	1050	1e-152
CLV2 [A. thaliana]	349	696	2e-33
Cf-9 [L. pimpinellifolium]	471	699	7e-18
Pto [L. esculentum]	746	1047	7e-31
Rpg1 [Hordeum vulgare]	759	968	9e-26
Rpg1 [Hordeum vulgare]	767	968	9e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	717	736	out -> in

Report for 3375.m00141

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)