Report for 3430.m00138

 > 3430.m00138, length: 375, copies: 1 

MTTATTTTTLPAAAALLLLLLSAAAQLCSACPPAASQTAENNPRLQRAYVALQALRRRVTDDPKNLTGGWCGPDV

CRYFGVYCAAAPDDPCAATVAGIDLNHGDLAATLPDELGLLTDLAVLHLNSNRFSGALPDTLPKLSLLHELDVSN

NRLAGGFPDHILCLPNVKYVDLRFNNFCGEVPPAIFDKKIDALFLNDNHFDFELPANLGNSPASVIVLANIKLRG

CIPSSVGRMAATLNELVVLNSGVRSCIPPEIGHLGELTVLDVSNNQLQGTLPESMAWMRSLEQLDVARNELAGHI

PEGICALPRLRNFTYSYNYFCGEPERCLRLRRVDDRQNCIAGRPDQRPADQCLAFLHRPPVHCDAHGCFAPPGHY

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	118	141	4.6
LRR [Pfam ls]	142	165	2.5
LRR [Pfam ls]	261	281	0.29
LRR [Pfam ls]	285	308	0.8

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	94	117	4.9
LRR [sensitive, ls]	94	117	100
LRR [sensitive, ls]	118	141	0.22
LRR [sensitive, ls]	118	141	4.6
LRR [sensitive, ls]	142	165	0.12
LRR [sensitive, ls]	142	165	2.5
LRR [sensitive, ls]	166	190	0.73
LRR [sensitive, ls]	166	190	15
LRR [sensitive, ls]	261	281	0.014
LRR [sensitive, ls]	261	281	0.29
LRR [sensitive, ls]	285	308	0.039
LRR [sensitive, ls]	285	308	0.8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	49	323	9e-19
FLS2 [A.thaliana]	51	322	1e-21
Xa21 [O. sativa]	76	323	7e-23
FLS2 [A.thaliana]	87	326	2e-15
CLV2 [A. thaliana]	93	342	9e-19
FLS2 [A.thaliana]	93	322	9e-19
FLS2 [A.thaliana]	97	322	6e-15
Cf-9 [L. pimpinellifolium]	98	303	6e-12
Cf-9 [L. pimpinellifolium]	98	322	7e-12
CLV2 [A. thaliana]	98	322	2e-21
FLS2 [A.thaliana]	98	323	2e-23
FLS2 [A.thaliana]	98	342	3e-20
FLS2 [A.thaliana]	98	302	2e-19
FLS2 [A.thaliana]	98	323	9e-19
Xa21 [O. sativa]	98	322	1e-17
Xa21 [O. sativa]	98	228	7e-12
FLS2 [A.thaliana]	99	279	2e-11
CLV2 [A. thaliana]	100	323	3e-15
Xa21 [O. sativa]	100	322	1e-20
Xa21 [O. sativa]	100	291	1e-16
Cf-9 [L. pimpinellifolium]	119	328	4e-12
Xa21 [O. sativa]	122	322	5e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 3430.m00138

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)