Report for 3442.m00286

 > 3442.m00286, length: 698, copies: 1 

NLTKLDMAYNMLEANDWSFVSSLSNCSRLTELMLDGNNLQGNLPSSIGNLSSSLEYLWLRNNQISWLIPPGIGNL

KSLNMLYMDYNYLTGNIPPTIGYLHNLVFLSFAQNRLSGQIPGTIGNLVQLNELNLDGNNLSGSIPESIHHCAQL

KTLNLAHNSLHGTIPVHIFKIFSLSEHLDLSHNYLSGGIPQEVGNLINLNKLSISNNRLSGNIPSALGQCVILES

LELQSNFLEGIIPESFAKLQSINKLDISHNKLSGKIPEFLASFKSLINLNLSFNNFYGPLPSFGVFLDTSVISIE

GNDRLCARAPLKGIPFCSALVDRGRVHRLLVLAFKIVTPVVVVVITILCFLMIRSRKRVPQNSRKSMQQEPHLRL

FNGDMEKITYQDIVKATNGFSSANLIGSGSFGTVYKGNLEFRQDQVAIKIFNLSTYGAHRSFAAECEALKNVRHR

NLVKVITVCSSVDSTGAEFRALVFEYIQNGNLQMWLHPKEHEHSQRNFLTLCQRINIALDIAFALDYLHNRCATP

LVHCDLKPSNILLGPDMVAYVSDFGLARFICTRSNSDQDSLTSLYCLKGSIGYIPPEYGMSEERSTKGDVYSFGV

LLLEMVTNISPTEEIFNDGTSLRDLVASNFPKDTFKVVDPTMLQDEIDATEVLQSCVILLVRIGLSCSMTSPKHR

CEMGQVCTEILGIKHALSKIDGE

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	28	51	0.045
LRR [Pfam ls]	53	76	0.058
LRR [Pfam ls]	77	100	5.5
LRR [Pfam ls]	101	124	5.4
LRR [Pfam ls]	125	148	0.046
LRR [Pfam ls]	149	173	0.057
LRR [Pfam ls]	198	221	0.2
LRR [Pfam ls]	222	245	0.13
LRR [Pfam ls]	246	269	0.088
Ser/Thr pkinase [Pfam fs]	395	614	2.1e-43
Ser/Thr pkinase [Pfam ls]	395	658	3.5e-38

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	1	24	0.38
LRR [sensitive, ls]	1	24	8.9
LRR [sensitive, ls]	28	51	0.0019
LRR [sensitive, ls]	28	51	0.045
LRR [sensitive, ls]	53	76	0.0025
LRR [sensitive, ls]	53	76	0.058
LRR [sensitive, ls]	77	100	0.24
LRR [sensitive, ls]	77	100	5.5
LRR [sensitive, ls]	101	124	0.23
LRR [sensitive, ls]	101	124	5.4
LRR [sensitive, ls]	125	148	0.002
LRR [sensitive, ls]	125	148	0.046
LRR [sensitive, ls]	149	173	0.0025
LRR [sensitive, ls]	149	173	0.057
LRR [sensitive, ls]	174	197	0.38
LRR [sensitive, ls]	174	197	8.8
LRR [sensitive, ls]	198	221	0.0085
LRR [sensitive, ls]	198	221	0.2
LRR [sensitive, ls]	222	245	0.0056
LRR [sensitive, ls]	222	245	0.13
LRR [sensitive, ls]	246	269	0.0038
LRR [sensitive, ls]	246	269	0.088
LRR [sensitive, ls]	270	292	0.55
LRR [sensitive, ls]	270	292	13

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	1	305	4e-31
Cf-9 [L. pimpinellifolium]	1	286	3e-28
Cf-9 [L. pimpinellifolium]	1	310	2e-26
CLV2 [A. thaliana]	1	311	1e-27
FLS2 [A.thaliana]	1	689	9e-91
FLS2 [A.thaliana]	1	320	1e-41
Xa21 [O. sativa]	1	506	1e-114
CLV2 [A. thaliana]	2	286	1e-31
CLV2 [A. thaliana]	2	310	6e-31
Xa21 [O. sativa]	2	302	3e-35
Xa21 [O. sativa]	2	322	4e-34
CLV2 [A. thaliana]	12	288	5e-33
CLV2 [A. thaliana]	15	286	4e-24
FLS2 [A.thaliana]	15	303	5e-41
Cf-9 [L. pimpinellifolium]	17	288	1e-22
Cf-9 [L. pimpinellifolium]	17	303	2e-16
FLS2 [A.thaliana]	18	287	3e-41
Xa21 [O. sativa]	22	311	1e-36
FLS2 [A.thaliana]	23	286	2e-38
Xa21 [O. sativa]	57	276	1e-28
Xa21 [O. sativa]	100	299	3e-27
Xa21 [O. sativa]	178	303	5e-13
Rpg1 [Hordeum vulgare]	378	688	1e-24
Pto [L. esculentum]	386	681	2e-23
Rpg1 [Hordeum vulgare]	392	606	6e-16

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	329	351	out -> in
putative TM domain	329	351	out -> in

Report for 3442.m00286

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)