Report for 3442.m00290

 > 3442.m00290, length: 1126, copies: 2 

MASSSVLSPNIAWVLCHFIFCSISLAICNETDDRQALLCFKSQLSGPSRVLSSWSNTSLNFCNWDGVTCSSRSPP

RVIAIDLSSEGITGTISPCIANLTSLMTLQLSNNSLHGSIPPKLGLLRKLRNLNLSMNSLEGNIPSQLSSYSQIE

ILDLSSNSFQGAIPASLGKCIHLQDINLSRNNLQGRISSAFGNLSKLQALVLTSNRLTDEIPPSLGSSFSLRYVD

LGNNDITGSIPESLANSSSLQVLRLMSNNLSGEVPKSLFNTSSLTAIFLQQNSFVGSIPAIAAMSSPIKYISLRD

NCISGTIPPSLGNLSSLLELRLSKNNLVGSIPESLGHIRTLEILTMSVNNLSGLVPPSLFNISSLTFLAMGNNSL

VGRLPSDIGYTLTKIQGLILPANKFVGPIPASLLNAYHLEMLYLGNNSFTGLVPFFGSLPNLEELDVSYNMLEPG

DWSFMTSLSNCSKLTQLMLDGNSFQGILPSSIGNLSSNLEGLWLRNNKIYGPIPPEIGNLKSLSILFMDYNLFTG

TIPQTIGNLNNLTVLSFAQNKLSGHIPDVFGNLVQLTDIKLDGNNFSGRIPSSIGQCTQLQILNLAHNSLDGNIP

SIIFKITSLSQEMNLSHNYLTGGMPDEVGNLINLNKLGISNNMLSGEIPSSLGQCVTLEYLEIQSNFFVGGIPQS

FMKLVSIKEMDISRNNLSGKIPQFLNLLSSLHDLNLSFNNFDGVIPTGGVFDIDNAVSIEGNNHLCTSVPKVGIP

SCSVLAERKRKLKILVLVLEILIPAIIAVIIILSYVVRIYGMKEMQANPHCQQINDHVKNITYQDIVKATDRFSS

ANLIGTGSFGTVYKGNLDRQQDEVAIKVFNLGIYGGQRSFSVECEALRNIRHRNLVKIITLCSSVDSNGADFKAL

VFQYMANGNLDTWLHPRAHEHSERKTLTFNQRINIALDVAFALDYLHNQCASPLVHCDLKPSNILLDLDMIAYVS

DFGLARCLNNTSNAYEGSSKSLACLKGSIGYIPPEYGMSEVISTKGDVYSFGVILLEMITGSSPTDEKINNGTSL

HEHVARAFPKNTYEIVDPRMLQGEMNITTVMQNCIIPLVRIGLCCSAASPKDRWEMGQVSAEILKIKHIFSSIHG

V

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	100	123	0.49
LRR [Pfam ls]	148	171	2
LRR [Pfam ls]	172	195	0.0087
LRR [Pfam ls]	196	216	4.7
LRR [Pfam ls]	220	243	0.023
LRR [Pfam ls]	292	315	1.8
LRR [Pfam ls]	316	339	0.66
LRR [Pfam ls]	413	435	0.022
LRR [Pfam ls]	436	462	4.8
LRR [Pfam ls]	463	486	0.059
LRR [Pfam ls]	488	511	0.59
LRR [Pfam ls]	512	535	6.2
LRR [Pfam ls]	536	559	0.057
LRR [Pfam ls]	560	583	2.6
LRR [Pfam ls]	584	607	3.7
LRR [Pfam ls]	633	656	1.1
LRR [Pfam ls]	657	680	3.5
LRR [Pfam ls]	681	703	0.73
Ser/Thr pkinase [Pfam fs]	823	1056	6.6e-45
Ser/Thr pkinase [Pfam ls]	823	1119	3e-39

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	100	123	0.021
LRR [sensitive, ls]	100	123	0.49
LRR [sensitive, ls]	124	144	0.49
LRR [sensitive, ls]	124	144	12
LRR [sensitive, ls]	148	171	0.085
LRR [sensitive, ls]	148	171	2
LRR [sensitive, ls]	172	195	0.00037
LRR [sensitive, ls]	172	195	0.0087
LRR [sensitive, ls]	196	216	0.2
LRR [sensitive, ls]	196	216	4.7
LRR [sensitive, ls]	220	243	0.001
LRR [sensitive, ls]	220	243	0.023
LRR [sensitive, ls]	244	267	0.41
LRR [sensitive, ls]	244	267	9.6
LRR [sensitive, ls]	268	290	0.7
LRR [sensitive, ls]	268	290	16
LRR [sensitive, ls]	292	315	0.079
LRR [sensitive, ls]	292	315	1.8
LRR [sensitive, ls]	316	339	0.028
LRR [sensitive, ls]	316	339	0.66
LRR [sensitive, ls]	340	363	0.41
LRR [sensitive, ls]	340	363	9.5
LRR [sensitive, ls]	364	388	0.38
LRR [sensitive, ls]	364	388	8.9
LRR [sensitive, ls]	413	435	0.00095
LRR [sensitive, ls]	413	435	0.022
LRR [sensitive, ls]	436	462	0.21
LRR [sensitive, ls]	436	462	4.8
LRR [sensitive, ls]	463	486	0.0025
LRR [sensitive, ls]	463	486	0.059
LRR [sensitive, ls]	488	511	0.025
LRR [sensitive, ls]	488	511	0.59
LRR [sensitive, ls]	512	535	0.27
LRR [sensitive, ls]	512	535	6.2
LRR [sensitive, ls]	536	559	0.0025
LRR [sensitive, ls]	536	559	0.057
LRR [sensitive, ls]	560	583	0.11
LRR [sensitive, ls]	560	583	2.6
LRR [sensitive, ls]	584	607	0.16
LRR [sensitive, ls]	584	607	3.7
LRR [sensitive, ls]	609	632	2.5
LRR [sensitive, ls]	609	632	58
LRR [sensitive, ls]	633	656	0.047
LRR [sensitive, ls]	633	656	1.1
LRR [sensitive, ls]	657	680	0.15
LRR [sensitive, ls]	657	680	3.5
LRR [sensitive, ls]	681	703	0.031
LRR [sensitive, ls]	681	703	0.73
LRR [sensitive, ls]	705	727	0.58
LRR [sensitive, ls]	705	727	13

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	6	1117	1e-176
CLV2 [A. thaliana]	30	745	4e-69
Cf-9 [L. pimpinellifolium]	53	740	1e-72
Xa21 [O. sativa]	226	934	1e-165
Xa21 [O. sativa]	612	722	3e-11
Rpg1 [Hordeum vulgare]	801	1036	9e-28
Pto [L. esculentum]	814	1109	1e-27
Rpg1 [Hordeum vulgare]	820	1036	9e-20

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	765	787	out -> in
putative TM domain	765	787	out -> in

Report for 3442.m00290

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)