Report for 3453.m00150

 > 3453.m00150, length: 1023, copies: 1 

MRLHYHHLAVVLLAAVAAAATAAAGGEADALLAVKAALDDPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDV

SGRNLTGGLPGAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALRVLDLY

NNNLTGALPLEVVSMAQLRHLHLGGNFFSGGIPPEYGRWGRLQYLAVSGNELSGKIPPELGNLTSLRELYIGYFN

SYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALA

GEIPATFADLKNLTLLNLFRNKLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTL

PPDLCAGGKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDNLISGGFPAV

SGTGAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIG

KCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYNNLSGLVPATGQFSY

FNATSFVGNPGLCGPYLGPCHPGAPGTDHGGRSHGGLSNSFKLLIVLGLLALSIAFAAMAILKARSLKKASEARA

WKLTAFQRLEFTCDDVLDSLKEENIIGKGGAGTVYKGTMPDGEHVAVKRLPAMSRGSSHDHGFSAEIQTLGRIRH

RYIVRLLGFCSNNETNLLVYEYMPNGSLGELLHGKKGGHLHWDTRYKVAVEAAKGLCYLHHDCSPPILHRDVKSN

NILLDSDFEAHVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGE

FGDGVDIVQWVKTMTDSNKEHVIKILDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQILSELPKPTSK

QGEEPPSGEGAVFDLVVPAESAEANEAKEQQQQQLNSPSSPPPDLISI

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	94	117	3.4
LRR [Pfam ls]	119	142	0.03
LRR [Pfam ls]	143	164	0.32
LRR [Pfam ls]	167	190	1.5
LRR [Pfam ls]	191	214	0.0096
LRR [Pfam ls]	240	263	0.73
LRR [Pfam ls]	288	311	0.015
LRR [Pfam ls]	312	335	0.1
LRR [Pfam ls]	360	384	0.029
LRR [Pfam ls]	408	431	1.3
LRR [Pfam ls]	432	456	6.8
LRR [Pfam ls]	457	480	2.5
LRR [Pfam ls]	481	504	6.3
LRR [Pfam ls]	529	552	0.0018
LRR [Pfam ls]	577	599	3.7
Ser/Thr pkinase [Pfam fs]	695	897	2.2e-51
Ser/Thr pkinase [Pfam ls]	695	944	1.5e-46

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	69	93	0.59
LRR [sensitive, ls]	69	93	12
LRR [sensitive, ls]	94	117	0.17
LRR [sensitive, ls]	94	117	3.4
LRR [sensitive, ls]	119	142	0.0014
LRR [sensitive, ls]	119	142	0.03
LRR [sensitive, ls]	143	164	0.016
LRR [sensitive, ls]	143	164	0.32
LRR [sensitive, ls]	167	190	0.071
LRR [sensitive, ls]	167	190	1.5
LRR [sensitive, ls]	191	214	0.00046
LRR [sensitive, ls]	191	214	0.0096
LRR [sensitive, ls]	240	263	0.035
LRR [sensitive, ls]	240	263	0.73
LRR [sensitive, ls]	264	287	0.49
LRR [sensitive, ls]	264	287	10
LRR [sensitive, ls]	288	311	0.00071
LRR [sensitive, ls]	288	311	0.015
LRR [sensitive, ls]	312	335	0.005
LRR [sensitive, ls]	312	335	0.1
LRR [sensitive, ls]	336	359	0.35
LRR [sensitive, ls]	336	359	7.3
LRR [sensitive, ls]	360	384	0.0014
LRR [sensitive, ls]	360	384	0.029
LRR [sensitive, ls]	408	431	0.065
LRR [sensitive, ls]	408	431	1.3
LRR [sensitive, ls]	432	456	0.33
LRR [sensitive, ls]	432	456	6.8
LRR [sensitive, ls]	457	480	0.12
LRR [sensitive, ls]	457	480	2.5
LRR [sensitive, ls]	481	504	0.3
LRR [sensitive, ls]	481	504	6.3
LRR [sensitive, ls]	505	528	1.2
LRR [sensitive, ls]	505	528	24
LRR [sensitive, ls]	529	552	8.7e-05
LRR [sensitive, ls]	529	552	0.0018
LRR [sensitive, ls]	553	576	0.55
LRR [sensitive, ls]	553	576	11
LRR [sensitive, ls]	577	599	0.18
LRR [sensitive, ls]	577	599	3.7

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	24	783	2e-88
FLS2 [A.thaliana]	27	595	7e-87
CLV2 [A. thaliana]	30	613	1e-56
Cf-9 [L. pimpinellifolium]	47	614	1e-58
FLS2 [A.thaliana]	73	969	1e-132
Pto [L. esculentum]	669	963	2e-39
Rpg1 [Hordeum vulgare]	680	969	3e-39
Rpg1 [Hordeum vulgare]	683	969	1e-29

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	26	in -> out

Report for 3453.m00150

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)