Report for 3479.m00120

 > 3479.m00120, length: 976, copies: 1 

MTPLLLLLLALAAGAGAASFPADFANLFAAKAALSDPSSALAAWDPGLSPSLSPCRWPHLLCSNPSSSSSAAIAA

VLLSNLSLAGEFPAPLCELRSLALLDLSYNDLTGPLPGCLAAMPSLRHLDLAGNGFSGEVPRSYGAGFPSLLTLS

LAGNELSGELPAFLANVSALEELLLAYNQFAPSPLPETFTGIRRLQVLWLAGCNLVGDIPPSIGSLKSLVNLDLS

TNNLTGEIPSSIGGLESVVQLELYSNQLTGSLPEGMSALKKLRFFDAAMNQLSGEIPADLFLAPRLESLHLYQNE

LTGRVPATVADAAALNDLRLFTNRLVGELPPEFGKKSPLEFLDLSDNRISGEIPATLCSAGKLEQLLMLNNELVG

PIPAELGQCRTLTRVRLPNNRLSGAVPPDMWGLPHLYLLELAGNALSGAVAPAIATARNLSQLLISDNRFAGALP

PELGSLPNLFELSASNNVFSGPLPASLTVVTTLGRLDLRNNSLSGELPRGVRRWQKLTQLDLADNRLTGNIPAEL

GDLPVLNSLDLSNNELTGGVPVQLENLKLSLLNLSNNRLAGVLPPLFAGEMYKDSFLGNPGLCTGGSCSSGRRAR

AGRRGLVGSVTVAVAGVILLLGAAWFAHRYRSQRRWSTEDAAGEKSRWVVTSFHKAEFDEEDILSCLDDEDNVVG

TGAAGKVYKAVLGNGARGGDDGAVVAVKKLWANGGAAKKAAAMEAGGGGGGGGKDTFEAEVATLGRIRHKNIVKL

WCSLSSGDRRLLVYEYMPNGSLGDLLHGGKGGLLDWPARHRIMVDAAEGLSYLHHDCAPPIVHRDVKSNNILLDA

DLRAKVADFGVARAVSAAPPTAVSAIAGSCGYMPPYSYTLRITEKSDVYSFGVVMLELLTGKAPAGPELGEKDLV

RWVCGCVERDGVDRVLDARLAGAPRDETRRALNVALLCASSLPINRPSMRSVVKLLLELRPESKEKAMAEEKPLL

V

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	96	119	0.16
LRR [Pfam ls]	120	144	0.099
LRR [Pfam ls]	145	168	2.7
LRR [Pfam ls]	194	217	0.05
LRR [Pfam ls]	218	241	0.032
LRR [Pfam ls]	242	265	0.95
LRR [Pfam ls]	338	361	2.6
LRR [Pfam ls]	386	409	5.2
LRR [Pfam ls]	434	457	1.1
LRR [Pfam ls]	482	505	5.7
LRR [Pfam ls]	506	529	0.0072
LRR [Pfam ls]	530	550	4.6
LRR [Pfam ls]	553	576	2.4
Ser/Thr pkinase [Pfam ls]	668	958	4.4e-37
Ser/Thr pkinase [Pfam fs]	673	889	1.4e-41

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	96	119	0.0061
LRR [sensitive, ls]	96	119	0.16
LRR [sensitive, ls]	120	144	0.0037
LRR [sensitive, ls]	120	144	0.099
LRR [sensitive, ls]	145	168	0.1
LRR [sensitive, ls]	145	168	2.7
LRR [sensitive, ls]	169	193	1.3
LRR [sensitive, ls]	169	193	35
LRR [sensitive, ls]	194	217	0.0019
LRR [sensitive, ls]	194	217	0.05
LRR [sensitive, ls]	218	241	0.0012
LRR [sensitive, ls]	218	241	0.032
LRR [sensitive, ls]	242	265	0.036
LRR [sensitive, ls]	242	265	0.95
LRR [sensitive, ls]	290	313	0.28
LRR [sensitive, ls]	290	313	7.5
LRR [sensitive, ls]	314	337	1.3
LRR [sensitive, ls]	314	337	34
LRR [sensitive, ls]	338	361	0.098
LRR [sensitive, ls]	338	361	2.6
LRR [sensitive, ls]	362	385	3.6
LRR [sensitive, ls]	362	385	96
LRR [sensitive, ls]	386	409	0.2
LRR [sensitive, ls]	386	409	5.2
LRR [sensitive, ls]	410	433	0.64
LRR [sensitive, ls]	410	433	17
LRR [sensitive, ls]	434	457	0.043
LRR [sensitive, ls]	434	457	1.1
LRR [sensitive, ls]	458	481	0.67
LRR [sensitive, ls]	458	481	18
LRR [sensitive, ls]	482	505	0.22
LRR [sensitive, ls]	482	505	5.7
LRR [sensitive, ls]	506	529	0.00027
LRR [sensitive, ls]	506	529	0.0072
LRR [sensitive, ls]	530	550	0.17
LRR [sensitive, ls]	530	550	4.6
LRR [sensitive, ls]	553	576	0.092
LRR [sensitive, ls]	553	576	2.4

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	2	573	1e-72
Xa21 [O. sativa]	3	777	3e-70
CLV2 [A. thaliana]	21	546	8e-57
Cf-9 [L. pimpinellifolium]	51	576	3e-41
Cf-9 [L. pimpinellifolium]	58	587	2e-50
CLV2 [A. thaliana]	70	593	1e-47
FLS2 [A.thaliana]	73	960	1e-103
FLS2 [A.thaliana]	78	569	3e-71
FLS2 [A.thaliana]	205	578	3e-55
Pto [L. esculentum]	652	960	4e-31
Rpg1 [Hordeum vulgare]	670	956	2e-28
Rpg1 [Hordeum vulgare]	670	954	1e-20

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	605	627	out -> in

Report for 3479.m00120

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)