Report for 3499.m00155

 > 3499.m00155, length: 1219, copies: 1 

MAAVRVVAPAPSVLLLVAAAVVLLHLARAIAGAADEAAALLAFKDASVAADPGGALAGWANSTTPGSPCAWAGVS

CAAGRVRALDLSGMSLSGRLRLDALLALSALRRLDLRGNAFHGDLSRHGSPRRAAPCALVEVDISSNTFNGTLPR

AFLASCGGLQTLNLSRNSLTGGGYPFPPSLRRLDMSRNQLSDAGLLNYSLTGCHGIQYLNLSANQFTGSLPGLAP

CTEVSVLDLSWNLMSGVLPPRFVAMAPANLTYLSIAGNNFSMDISDYEFGGCANLTLLDWSYNRLRSTGLPRSLV

DCRRLEALDMSGNKLLSGPIPTFLVELQALRRLSLAGNRFTGEISDKLSILCKTLVELDLSSNQLIGSLPASFGQ

CRFLQVLDLGNNQLSGDFVETVITNISSLRVLRLPFNNITGANPLPALASRCPLLEVIDLGSNEFDGEIMPDLCS

SLPSLRKLLLPNNYINGTVPSSLSNCVNLESIDLSFNLLVGQIPPEILFLLKLVDLELVDLVLWANNLSGEIPDK

FCFNSTALETLVISYNSFTGNIPESITRCVNLIWLSLAGNNLTGSIPSGFGNLQNLAILQLNKNSLSGKVPAELG

SCSNLIWLDLNSNELTGTIPPQLAAQAGLITGAIVSGKQFAFLRNEAGNICPGAGVLFEFLDIRPDRLANFPAVH

LCSSTRIYTGTTVYTFRNNGSMIFLDLSYNSLTGTIPASFGNMTYLEVLNLGHNELTGAIPDAFTGLKGIGALDL

SHNHLTGVIPPGFGCLHFLADFDVSNNNLTGEIPTSGQLITFPASRYENNSGLCGIPLNPCVHNSGAGGLPQTSY

GHRNFARQSVFLAVTLSVLILFSLLIIHYKLWKFHKNKTKEIQAGCSESLPGSSKSSWKLSGIGEPLSINMAIFE

NPLRKLTFSDLHQATNGFCAETLIGSGGFGEVYKAKLKDGNIVAVKKLMHFTGQGDREFTAEMETIGKIKHRNLV

PLLGYCKIGDERLLVYEYMKNGSLDFVLHDKGEANMDLNWATRKKIAIGSARGLAFLHHSCVPHIIHRDMKSSNV

LLDGNFDAYVSDFGMARLMNALDSHLTVSMLSGTPGYVPPEYCQDFRCTTKGDVYSYGVVLLELLTGKKPIDPTE

FGDSNLVGWVKQMVEDRCSEIYDPTLMATTSSELELYQYLKIACRCLDDQPNRRPTMIQVMTMFKEFQVDSGSNF

LDDFSLNSTNMEESSEKSV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	179	204	0.64
LRR [Pfam ls]	205	227	0.62
LRR [Pfam ls]	254	278	2.7
LRR [Pfam ls]	304	328	4.9
LRR [Pfam ls]	329	349	5.2
LRR [Pfam ls]	354	377	0.087
LRR [Pfam ls]	378	402	1
LRR [Pfam ls]	403	424	4.7
LRR [Pfam ls]	429	453	1.5
LRR [Pfam ls]	454	477	5
LRR [Pfam ls]	478	502	0.0096
LRR [Pfam ls]	556	579	0.003
LRR [Pfam ls]	580	603	4.4
LRR [Pfam ls]	604	624	0.31
LRR [Pfam ls]	696	719	0.016
LRR [Pfam ls]	720	743	0.0021
LRR [Pfam ls]	744	767	0.12
Ser/Thr pkinase [Pfam fs]	918	1189	5.3e-48
Ser/Thr pkinase [Pfam ls]	918	1189	1.6e-48

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	80	104	0.31
LRR [sensitive, ls]	80	104	8.3
LRR [sensitive, ls]	105	126	0.67
LRR [sensitive, ls]	105	126	18
LRR [sensitive, ls]	133	157	0.74
LRR [sensitive, ls]	133	157	20
LRR [sensitive, ls]	158	177	0.87
LRR [sensitive, ls]	158	177	23
LRR [sensitive, ls]	179	204	0.024
LRR [sensitive, ls]	179	204	0.64
LRR [sensitive, ls]	205	227	0.024
LRR [sensitive, ls]	205	227	0.62
LRR [sensitive, ls]	228	251	0.95
LRR [sensitive, ls]	228	251	25
LRR [sensitive, ls]	254	278	0.1
LRR [sensitive, ls]	254	278	2.7
LRR [sensitive, ls]	279	303	3.2
LRR [sensitive, ls]	279	303	85
LRR [sensitive, ls]	304	328	0.18
LRR [sensitive, ls]	304	328	4.9
LRR [sensitive, ls]	329	349	0.2
LRR [sensitive, ls]	329	349	5.2
LRR [sensitive, ls]	354	377	0.0033
LRR [sensitive, ls]	354	377	0.087
LRR [sensitive, ls]	378	402	0.039
LRR [sensitive, ls]	378	402	1
LRR [sensitive, ls]	403	424	0.18
LRR [sensitive, ls]	403	424	4.7
LRR [sensitive, ls]	429	453	0.055
LRR [sensitive, ls]	429	453	1.5
LRR [sensitive, ls]	454	477	0.19
LRR [sensitive, ls]	454	477	5
LRR [sensitive, ls]	478	502	0.00036
LRR [sensitive, ls]	478	502	0.0096
LRR [sensitive, ls]	507	531	0.66
LRR [sensitive, ls]	507	531	18
LRR [sensitive, ls]	532	555	0.38
LRR [sensitive, ls]	532	555	10
LRR [sensitive, ls]	556	579	0.00011
LRR [sensitive, ls]	556	579	0.003
LRR [sensitive, ls]	580	603	0.17
LRR [sensitive, ls]	580	603	4.4
LRR [sensitive, ls]	604	624	0.012
LRR [sensitive, ls]	604	624	0.31
LRR [sensitive, ls]	696	719	0.0006
LRR [sensitive, ls]	696	719	0.016
LRR [sensitive, ls]	720	743	7.8e-05
LRR [sensitive, ls]	720	743	0.0021
LRR [sensitive, ls]	744	767	0.0047
LRR [sensitive, ls]	744	767	0.12
LRR [sensitive, ls]	768	791	1.2
LRR [sensitive, ls]	768	791	31

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	15	1187	1e-116
Xa21 [O. sativa]	33	620	7e-44
Cf-9 [L. pimpinellifolium]	59	809	6e-57
CLV2 [A. thaliana]	62	804	1e-46
Xa21 [O. sativa]	289	1004	1e-75
Rpg1 [Hordeum vulgare]	902	1202	3e-31
Rpg1 [Hordeum vulgare]	904	1186	3e-38
Pto [L. esculentum]	905	1186	4e-42

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	12	34	in -> out
putative TM domain	835	857	out -> in

Report for 3499.m00155

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)