Report for 3674.m00152

 > 3674.m00152, length: 751, copies: 1 

MFYQMLAAILQALLIAQMIHGQSDKEVLVQLKNFLQVQNPINHGAYVSWSESEASPCHWKGVGCDDAGHVNSLDL

SNSNIAGPLFRNFSRIMRLTHLNLSSNSITGELQDDLKQCQSLQHLNISNNLIGGILDLSSLTNLQTLDVSQNRF

QGRIDRNFPGICGNLTFLSVSSNSFTGRIDKLFDGCPKLKHVDLSWNGFTGMVWPGIERLRQFKANNNNLTGRIS

PGMFTEGCKLRSLNIAINSLHGSFPSSIGNCSNMKFLSLWENSFYGSIPPGIGSIARLEELVLASNSFDGIIPME

LTNCTNLKYLDISDNNFGGEVQDVFGKLTCMRSLLLQENNYTGGITSSGILQLPNLIVLDLCYNQFSGDLPSEIS

SMKNLKVLMLAENNFSGKIPPTYGQLLRLQVLDLSFNSLSGEIPPDIGNLSSLLLLILAGNQISGEIPREIGNCT

SLVWLNLAGNQLMGQIPPEMANIGSNPSPTFMENRKNPELLESITSKCVAVEWLPSSYPEFNFVQSLMMSQKNCQ

TIWNRLAMGYDVLPISSPLRTALGYVQLSGNLLSGEIPSAIGTMKNFSLLLLDGNRLSGHLPAEIGHLQLVALNI

SSNFISGEIPSEIGHMVTLESLDLSSNNFSGALPSNLNQLTKLSRFNLSYNPLLSGNVPSSGQLSTFDEQSFLGD

PLLSLNVTAGSSSDSSPREFSSSDTEEHPTNEEIMVTTIAFLAFFSVTLLTREFHIFMYLYFTASRKIANCRIIC

T

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	93	116	0.029
LRR [Pfam ls]	117	138	0.034
LRR [Pfam ls]	139	159	1.4
LRR [Pfam ls]	164	187	0.32
LRR [Pfam ls]	234	257	6.2
LRR [Pfam ls]	306	329	0.015
LRR [Pfam ls]	355	378	0.16
LRR [Pfam ls]	379	402	4.6
LRR [Pfam fs]	403	426	1.5e-05
LRR [Pfam ls]	403	426	0.00024
LRR [Pfam ls]	427	450	0.61
LRR [Pfam ls]	451	474	5.5
LRR [Pfam ls]	547	570	5.5
LRR [Pfam ls]	594	617	0.58
LRR [Pfam ls]	618	641	0.026

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	69	89	0.84
LRR [sensitive, ls]	69	89	22
LRR [sensitive, ls]	93	116	0.0011
LRR [sensitive, ls]	93	116	0.029
LRR [sensitive, ls]	117	138	0.0013
LRR [sensitive, ls]	117	138	0.034
LRR [sensitive, ls]	139	159	0.052
LRR [sensitive, ls]	139	159	1.4
LRR [sensitive, ls]	164	187	0.012
LRR [sensitive, ls]	164	187	0.32
LRR [sensitive, ls]	188	214	0.41
LRR [sensitive, ls]	188	214	11
LRR [sensitive, ls]	234	257	0.23
LRR [sensitive, ls]	234	257	6.2
LRR [sensitive, ls]	258	281	1.5
LRR [sensitive, ls]	258	281	41
LRR [sensitive, ls]	282	305	0.28
LRR [sensitive, ls]	282	305	7.3
LRR [sensitive, ls]	306	329	0.00055
LRR [sensitive, ls]	306	329	0.015
LRR [sensitive, ls]	355	378	0.0061
LRR [sensitive, ls]	355	378	0.16
LRR [sensitive, ls]	379	402	0.17
LRR [sensitive, ls]	379	402	4.6
LRR [sensitive, ls]	403	426	8.9e-06
LRR [sensitive, ls]	403	426	0.00024
LRR [sensitive, ls]	427	450	0.023
LRR [sensitive, ls]	427	450	0.61
LRR [sensitive, ls]	451	474	0.21
LRR [sensitive, ls]	451	474	5.5
LRR [sensitive, ls]	547	570	0.21
LRR [sensitive, ls]	547	570	5.5
LRR [sensitive, ls]	571	591	3.1
LRR [sensitive, ls]	571	591	82
LRR [sensitive, ls]	594	617	0.022
LRR [sensitive, ls]	594	617	0.58
LRR [sensitive, ls]	618	641	0.001
LRR [sensitive, ls]	618	641	0.026
LRR [sensitive, ls]	642	665	1.1
LRR [sensitive, ls]	642	665	28

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	24	611	1e-59
Cf-9 [L. pimpinellifolium]	47	702	4e-51
CLV2 [A. thaliana]	48	661	7e-53
Xa21 [O. sativa]	51	350	5e-25
FLS2 [A.thaliana]	57	697	2e-70
FLS2 [A.thaliana]	69	675	2e-71
Cf-9 [L. pimpinellifolium]	73	467	2e-39
CLV2 [A. thaliana]	73	498	7e-32
FLS2 [A.thaliana]	73	666	4e-66
Xa21 [O. sativa]	102	443	1e-29
FLS2 [A.thaliana]	123	668	2e-56
Xa21 [O. sativa]	197	669	3e-56
Xa21 [O. sativa]	234	669	7e-47
Xa21 [O. sativa]	262	659	2e-46
Xa21 [O. sativa]	313	661	6e-27

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	715	737	out -> in

Report for 3674.m00152

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)