Report for 3718.m00146

 > 3718.m00146, length: 434, copies: 2 

MALPPPLLRFFIVAVLLSSVAAWVAAATTLHERDAAALRDVRAGLRDLPGSRFFESWDDATDPCDYAGVVCEPDE

DDPAALRVSVLTLGTGLTDSPGLAGTLPASLASLTALTDFVLYPGRVAGAIPTDIGSGLRRLRLLSMSGNQLTGQ

IPESLAGLPDLHTLDLGNNHLDGSIPSGLLLPSSQSLKVLILANNGGLSGQIPDQFSSSQLFHVDLSRNSITGSL

PPLAQTVRYFSVAANSMQGSLDGAFGNGSAPTDLAFLDLSMNNFSGSIPRELFALPSASSLLLSRNNFTGSLAVP

AFASERAATPPWSVVDVSHNGITGEVPEELAAVESLYVNNNRMYGEVPEAVARSVFAGRMTTFYAQHNFLTGFPV

PPLPLPDSAALCLSYNCMELPSASAANGCPTIGGPMESRPADQCRSSTAANAGSSGGDG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	136	159	0.0036
LRR [Pfam ls]	160	184	1.1
LRR [Pfam ls]	210	232	3

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	136	159	0.00015
LRR [sensitive, ls]	136	159	0.0036
LRR [sensitive, ls]	160	184	0.049
LRR [sensitive, ls]	160	184	1.1
LRR [sensitive, ls]	186	207	0.4
LRR [sensitive, ls]	186	207	9.2
LRR [sensitive, ls]	210	232	0.13
LRR [sensitive, ls]	210	232	3
LRR [sensitive, ls]	258	281	0.36
LRR [sensitive, ls]	258	281	8.4
LRR [sensitive, ls]	282	306	2.2
LRR [sensitive, ls]	282	306	51
LRR [sensitive, ls]	359	381	4.9
LRR [sensitive, ls]	359	381	110

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	10	393	9e-18
FLS2 [A.thaliana]	24	351	7e-19
Xa21 [O. sativa]	50	372	3e-18
FLS2 [A.thaliana]	83	350	8e-23
FLS2 [A.thaliana]	94	396	9e-21
Xa21 [O. sativa]	94	297	2e-15
Cf-9 [L. pimpinellifolium]	95	378	2e-16
CLV2 [A. thaliana]	97	392	1e-19
CLV2 [A. thaliana]	98	360	3e-15
FLS2 [A.thaliana]	98	352	5e-22
Xa21 [O. sativa]	98	391	2e-22
CLV2 [A. thaliana]	99	353	6e-17
CLV2 [A. thaliana]	100	347	2e-19
FLS2 [A.thaliana]	100	408	6e-20
Xa21 [O. sativa]	100	381	8e-18
Cf-9 [L. pimpinellifolium]	106	372	3e-11
Cf-9 [L. pimpinellifolium]	110	330	2e-12
FLS2 [A.thaliana]	132	372	3e-17
Cf-9 [L. pimpinellifolium]	136	330	2e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	7	29	in -> out

Report for 3718.m00146

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)