Report for 3728.m00162

 > 3728.m00162, length: 1155, copies: 1 

MSRHLLLLLALLLLLLLFPLATSAQPPPPSNTSASTSAAAVLLSFLDSLPPASQRLLLPSWRQSRSSSSSGNATA

PPPHCAFLGVTCSDTGAVAALNLSGVGLTGALSASAPRLCALPASALPVLDLSGNGFTGAVPAALAACAGVATLL

LGGNNLSGGVPPELLSSRQLVEVDLNGNALTGEIPAPAGSPVVLEYLDLSGNSLSGAVPPELAALPDLRYLDLSI

NRLTGPMPEFPVHCRLKFLGLYRNQIAGELPKSLGNCGNLTVLFLSYNNLTGEVPDFFASMPNLQKLYLDDNHFA

GELPASIGELVSLEKLVVTANRFTGTIPETIGNCRCLIMLYLNSNNFTGSIPAFIGNLSRLEMFSMAENGITGSI

PPEIGKCRQLVDLQLHKNSLTGTIPPEIGELSRLQKLYLYNNLLHGPVPQALWRLVDMVELFLNDNRLSGEVHED

ITQMSNLREITLYNNNFTGELPQALGMNTTSGLLRVDFTRNRFRGAIPPGLCTRGQLAVLDLGNNQFDGGFSSGI

AKCESLYRVNLNNNKLSGSLPADLSTNRGVTHLDISGNLLKGRIPGALGLWHNLTRLDVSGNKFSGPIPHELGAL

SILDTLLMSSNRLTGAIPHELGNCKRLAHLDLGNNLLNGSIPAEITTLSGLQNLLLGGNKLAGPIPDSFTATQSL

LELQLGSNNLEGGIPQSVGNLQYISQGLNISNNRLSGPIPHSLGNLQKLEVLDLSNNSLSGPIPSQLSNMISLSV

VNISFNELSGQLPDGWDKIATRLPQGFLGNPQLCVPSGNAPCTKYQSAKNKRRNTQIIVALLVSTLALMIASLVI

IHFIVKRSQRLSANRVSMRNLDSTEELPEDLTYEDILRATDNWSEKYVIGRGRHGTVYRTELAVGKQWAVKTVDL

SQCKFPIEMKILNTVKHRNIVRMAGYCIRSNIGLILYEYMPEGTLFELLHERTPQVSLDWNVRHQIALGVAESLS

YLHHDCVPMIIHRDVKSSNILMDAELVPKLTDFGMGKIIDDDDADATVSVVVGTLGYIAPEHGYSTRLSEKSDVY

SYGVVLLELLCRKMPVDPAFGDGVDIVTWMGSNLNQADHSNIMRFLDEEIIYWPEHEKAKVLDLLDLAMTCTQVS

CQLRPSMREVVSILMRIERSNHVQFFEEAP

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	169	191	0.6
LRR [Pfam ls]	193	216	0.0074
LRR [Pfam ls]	217	239	3.6
LRR [Pfam ls]	240	263	4
LRR [Pfam ls]	264	287	0.0024
LRR [Pfam ls]	288	311	0.54
LRR [Pfam ls]	336	359	0.59
LRR [Pfam ls]	384	407	0.13
LRR [Pfam ls]	408	431	0.19
LRR [Pfam ls]	456	480	0.24
LRR [Pfam ls]	530	553	0.88
LRR [Pfam ls]	554	577	1
LRR [Pfam ls]	578	601	0.017
LRR [Pfam ls]	626	649	0.33
LRR [Pfam ls]	650	673	3.8
LRR [Pfam ls]	674	697	0.72
LRR [Pfam ls]	723	746	0.014
Ser/Thr pkinase [Pfam fs]	868	1062	3.8e-46
Ser/Thr pkinase [Pfam ls]	868	1140	4.8e-45

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	121	144	0.32
LRR [sensitive, ls]	121	144	7.4
LRR [sensitive, ls]	145	168	0.59
LRR [sensitive, ls]	145	168	14
LRR [sensitive, ls]	169	191	0.025
LRR [sensitive, ls]	169	191	0.6
LRR [sensitive, ls]	193	216	0.00032
LRR [sensitive, ls]	193	216	0.0074
LRR [sensitive, ls]	217	239	0.15
LRR [sensitive, ls]	217	239	3.6
LRR [sensitive, ls]	240	263	0.17
LRR [sensitive, ls]	240	263	4
LRR [sensitive, ls]	264	287	0.0001
LRR [sensitive, ls]	264	287	0.0024
LRR [sensitive, ls]	288	311	0.023
LRR [sensitive, ls]	288	311	0.54
LRR [sensitive, ls]	312	335	0.25
LRR [sensitive, ls]	312	335	5.8
LRR [sensitive, ls]	336	359	0.025
LRR [sensitive, ls]	336	359	0.59
LRR [sensitive, ls]	360	383	0.27
LRR [sensitive, ls]	360	383	6.2
LRR [sensitive, ls]	384	407	0.0056
LRR [sensitive, ls]	384	407	0.13
LRR [sensitive, ls]	408	431	0.0081
LRR [sensitive, ls]	408	431	0.19
LRR [sensitive, ls]	432	455	0.52
LRR [sensitive, ls]	432	455	12
LRR [sensitive, ls]	456	480	0.01
LRR [sensitive, ls]	456	480	0.24
LRR [sensitive, ls]	482	502	2.3
LRR [sensitive, ls]	482	502	53
LRR [sensitive, ls]	506	529	0.37
LRR [sensitive, ls]	506	529	8.5
LRR [sensitive, ls]	530	553	0.038
LRR [sensitive, ls]	530	553	0.88
LRR [sensitive, ls]	554	577	0.045
LRR [sensitive, ls]	554	577	1
LRR [sensitive, ls]	578	601	0.00074
LRR [sensitive, ls]	578	601	0.017
LRR [sensitive, ls]	602	625	0.47
LRR [sensitive, ls]	602	625	11
LRR [sensitive, ls]	626	649	0.014
LRR [sensitive, ls]	626	649	0.33
LRR [sensitive, ls]	650	673	0.16
LRR [sensitive, ls]	650	673	3.8
LRR [sensitive, ls]	674	697	0.031
LRR [sensitive, ls]	674	697	0.72
LRR [sensitive, ls]	699	722	0.55
LRR [sensitive, ls]	699	722	13
LRR [sensitive, ls]	723	746	0.00058
LRR [sensitive, ls]	723	746	0.014
LRR [sensitive, ls]	747	770	0.46
LRR [sensitive, ls]	747	770	11

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	1	715	2e-70
CLV2 [A. thaliana]	19	622	2e-62
FLS2 [A.thaliana]	79	1142	1e-149
Cf-9 [L. pimpinellifolium]	80	765	2e-65
CLV2 [A. thaliana]	197	792	1e-64
Xa21 [O. sativa]	240	953	7e-91
Cf-9 [L. pimpinellifolium]	305	854	2e-42
CLV2 [A. thaliana]	337	764	1e-46
CLV2 [A. thaliana]	384	768	4e-43
CLV2 [A. thaliana]	433	769	1e-34
FLS2 [A.thaliana]	461	763	1e-39
Xa21 [O. sativa]	577	763	2e-27
Rpg1 [Hordeum vulgare]	855	1142	4e-29
Pto [L. esculentum]	859	1136	2e-35
Rpg1 [Hordeum vulgare]	865	1143	2e-22

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	5	24	in -> out
putative TM domain	808	830	out -> in

Report for 3728.m00162

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)