Report for 3728.m00164

 > 3728.m00164, length: 1130, copies: 1 

MSHAPRFLLFLLQLLAASVVARPPPPERADSAAVLRSFLASLPPPSRRVLRPSWRRGGGGGAPHCAFLGVTCDAA

GAVAALNLSGAGLAGELAASAPRLCALPALAALDLSRNGFTGSVPAALAACSCIATLVLSFNSLSGAVPPEILSS

RRLRKVDLNSNALTGEIPTTGLAAGSSVLEYLDLCVNSLSGAIPPELAAALPELTYLDLSSNNLSGPMPEFPPRC

GLVYLSLYSNQLAGELPRSLTNCGNLTVLYLSYNKIGGEVPDFFASMANLQTLYLDDNAFVGELPASIGELVNLE

ELVVSENAFTGTIPEAIGRCRSLTMLYLNGNRFTGSIPKFIGDLTRLQLFSIADNGITGEIPPEIGKCRGLVEIA

LQNNSLSGMIPPDIAELNQLQKLSLFDNILRGPVPLALWRLSNMAVLQLNNNSFSGEIHSDITQMRNLTNITLYN

NNFTGELPQELGLNTTPGLLHIDLTRNHFRGAIPPGLCTGGQLAVLDLGYNQFDGGFPSEIAKCQSLYRVNLNNN

QINGSLPADFGTNWGLSYIDMSSNLLEGIIPSALGSWSNLTKLDLSSNSFSGPIPRELGNLSNLGTLRMSSNRLT

GPIPHELGNCKKLALLDLGNNFLSGSIPAEITTLGSLQNLLLAGNNLTGTIPDSFTATQALLELQLGDNSLEGAI

PHSLGSLQYISKALNISNNQLSGQIPSSLGNLQDLEVLDLSNNSLSGIIPSQLINMISLSVVNLSFNKLSGELPA

GWAKLAAQSPESFLGNPQLCVHSSDAPCLKSQSAKNRTWKTRIVVGLVISSFSVMVASLFAIRYILKRSQRLSTN

RVSVRNMDSTEELPEELTYEDILRGTDNWSEKYVIGRGRHGTVYRTECKLGKQWAVKTVDLSQCKLPIEMKILNT

VKHRNIVRMAGYCIRGSVGLILYEYMPEGTLFELLHRRKPHAALDWTVRHQIAFGVAQGLSYLHHDCVPMIVHRD

VKSSNILMDTELVPKLTDFGMGKIVEDDDLDATVSVVVGTLGYIAPEHGYYTRLTEKSDVYSYGVVLLELLCRKM

PVDPAFGDSVDIVTWMRSNLTQADRRVIMECLDEEIMYWPEDEQAKALDLLDLAMYCTQLACQSRPSMREVVNNL

MRMDK

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	104	127	4.4
LRR [Pfam ls]	178	202	2.3
LRR [Pfam ls]	203	222	0.5
LRR [Pfam ls]	226	249	3.6
LRR [Pfam ls]	250	273	0.028
LRR [Pfam ls]	274	297	0.38
LRR [Pfam ls]	298	321	0.48
LRR [Pfam ls]	322	345	0.039
LRR [Pfam ls]	346	369	1.5
LRR [Pfam ls]	370	393	3.2
LRR [Pfam ls]	394	417	3.5
LRR [Pfam ls]	418	441	4.9
LRR [Pfam ls]	442	465	0.51
LRR [Pfam ls]	492	515	5
LRR [Pfam ls]	516	539	3.9
LRR [Pfam ls]	540	563	0.18
LRR [Pfam ls]	564	587	0.012
LRR [Pfam ls]	588	611	0.51
LRR [Pfam ls]	612	635	0.5
LRR [Pfam ls]	636	659	0.33
LRR [Pfam ls]	660	683	2.3
LRR [Pfam ls]	709	732	0.051
LRR [Pfam ls]	733	756	0.71
Ser/Thr pkinase [Pfam fs]	854	1048	3.3e-47
Ser/Thr pkinase [Pfam ls]	854	1127	1.3e-47

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	104	127	0.19
LRR [sensitive, ls]	104	127	4.4
LRR [sensitive, ls]	128	151	0.97
LRR [sensitive, ls]	128	151	23
LRR [sensitive, ls]	152	173	0.26
LRR [sensitive, ls]	152	173	6
LRR [sensitive, ls]	178	202	0.098
LRR [sensitive, ls]	178	202	2.3
LRR [sensitive, ls]	203	222	0.021
LRR [sensitive, ls]	203	222	0.5
LRR [sensitive, ls]	226	249	0.16
LRR [sensitive, ls]	226	249	3.6
LRR [sensitive, ls]	250	273	0.0012
LRR [sensitive, ls]	250	273	0.028
LRR [sensitive, ls]	274	297	0.016
LRR [sensitive, ls]	274	297	0.38
LRR [sensitive, ls]	298	321	0.021
LRR [sensitive, ls]	298	321	0.48
LRR [sensitive, ls]	322	345	0.0017
LRR [sensitive, ls]	322	345	0.039
LRR [sensitive, ls]	346	369	0.063
LRR [sensitive, ls]	346	369	1.5
LRR [sensitive, ls]	370	393	0.14
LRR [sensitive, ls]	370	393	3.2
LRR [sensitive, ls]	394	417	0.15
LRR [sensitive, ls]	394	417	3.5
LRR [sensitive, ls]	418	441	0.21
LRR [sensitive, ls]	418	441	4.9
LRR [sensitive, ls]	442	465	0.022
LRR [sensitive, ls]	442	465	0.51
LRR [sensitive, ls]	468	488	0.47
LRR [sensitive, ls]	468	488	11
LRR [sensitive, ls]	492	515	0.22
LRR [sensitive, ls]	492	515	5
LRR [sensitive, ls]	516	539	0.17
LRR [sensitive, ls]	516	539	3.9
LRR [sensitive, ls]	540	563	0.0079
LRR [sensitive, ls]	540	563	0.18
LRR [sensitive, ls]	564	587	0.00052
LRR [sensitive, ls]	564	587	0.012
LRR [sensitive, ls]	588	611	0.022
LRR [sensitive, ls]	588	611	0.51
LRR [sensitive, ls]	612	635	0.021
LRR [sensitive, ls]	612	635	0.5
LRR [sensitive, ls]	636	659	0.014
LRR [sensitive, ls]	636	659	0.33
LRR [sensitive, ls]	660	683	0.099
LRR [sensitive, ls]	660	683	2.3
LRR [sensitive, ls]	685	708	0.92
LRR [sensitive, ls]	685	708	22
LRR [sensitive, ls]	709	732	0.0022
LRR [sensitive, ls]	709	732	0.051
LRR [sensitive, ls]	733	756	0.031
LRR [sensitive, ls]	733	756	0.71

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	27	701	8e-72
FLS2 [A.thaliana]	60	1128	1e-144
Cf-9 [L. pimpinellifolium]	65	751	1e-68
CLV2 [A. thaliana]	69	778	3e-63
Xa21 [O. sativa]	227	936	3e-91
Rpg1 [Hordeum vulgare]	841	1049	2e-26
Pto [L. esculentum]	845	1122	5e-34
Rpg1 [Hordeum vulgare]	851	1129	4e-20

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	794	816	out -> in

Report for 3728.m00164

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)