Report for 3747.m00136

 > 3747.m00136, length: 1037, copies: 3 

MARSPTSVMISSLLLLLLIGPASSDDAAAAAAARTSTGGVAGDELALLSFKSSLLHQGGLSLASWNTSGHGQHCT

WVGVVCGRRRRRHPHRVVKLLLRSSNLSGIISPSLGNLSFLRELDLSDNYLSGEIPPELSRLSRLQLLELSGNSI

QGSIPAAIGACTKLTSLDLSHNQLRGMIPREIGASLKHLSNLYLHTNGLSGEIPSALGNLTSLQYFDLSCNRLSG

AIPSSLGQLSSSLLTMNLRQNNLSGMIPNSIWNLSSLRAFSVSENKLGGMIPTNAFKTLHLLEVIDMGTNRFYGK

IPASVANASHLTQLQIDGNLFSGIITSGFGRLRNLTTLYLWRNLFQTREQEDWGFISDLTNCSKLQTLDLGENNL

GGVLPNSFSNLSTSLSFLALDLNKITGSIPKDIGNLIGLQHLYLCNNNFRGSLPSSLGRLRNLGILVAYENNLSG

SIPLAIGNLTELNILLLGTNKFSGWIPYTLSNLTNLLSLGLSTNNLSGPIPSELFNIQTLSIMINVSKNNLEGSI

PQEIGHLKNLVEFHAESNRLSGKIPNTLGDCQLLRYLYLQNNLLSGSIPSALGQLKGLETLDLSSNNLSGQIPTS

LADITMLHSLNLSFNSFMGEVPTIGAFADASGISIQGNAKLCGGIPDLHLPRCCPLLENRKHFPVLPISVSLVAA

LAILSSLYLLITWHKRTKKGAPSRTSMKGHPLVSYSQLVKATDGFAPTNLLGSGSFGSVYKGKLNIQDHVAVKVL

KLENPKALKSFTAECEALRNMRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPSGSLEDWIHPETNDPADQRHLNL

HRRVTILLDVACALDYLHRHGPEPVVHCDVKSSNVLLDSDMVAHVGDFGLARILVDGTSLIQQSTSSMGFRGTIG

YAAPEYGVGHIASTHGDIYSYGILVLEIVTGKRPTDSTFRPDLGLRQYVELGLHGRVTDVVDTKLILDSENWLNS

TNNSPCRRITECIVSLLRLGLSCSQVLPLSRTPTGDIIDELNAIKQNLSGLFPVCEGASLEF

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	115	138	0.00097
LRR [Pfam ls]	139	162	0.007
LRR [Pfam ls]	163	187	0.0042
LRR [Pfam ls]	188	211	0.13
LRR [Pfam ls]	212	235	0.031
LRR [Pfam ls]	237	260	0.86
LRR [Pfam ls]	261	285	2.9
LRR [Pfam ls]	310	333	0.92
LRR [Pfam ls]	364	387	0.0019
LRR [Pfam ls]	413	436	0.048
LRR [Pfam ls]	437	460	4.1
LRR [Pfam ls]	558	581	0.0093
LRR [Pfam ls]	582	605	0.076
Ser/Thr pkinase [Pfam fs]	720	936	8.5e-50
Ser/Thr pkinase [Pfam ls]	720	993	1.3e-43

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	91	114	0.57
LRR [sensitive, ls]	91	114	6.3
LRR [sensitive, ls]	115	138	8.8e-05
LRR [sensitive, ls]	115	138	0.00097
LRR [sensitive, ls]	139	162	0.00064
LRR [sensitive, ls]	139	162	0.007
LRR [sensitive, ls]	163	187	0.00039
LRR [sensitive, ls]	163	187	0.0042
LRR [sensitive, ls]	188	211	0.012
LRR [sensitive, ls]	188	211	0.13
LRR [sensitive, ls]	212	235	0.0029
LRR [sensitive, ls]	212	235	0.031
LRR [sensitive, ls]	237	260	0.079
LRR [sensitive, ls]	237	260	0.86
LRR [sensitive, ls]	261	285	0.26
LRR [sensitive, ls]	261	285	2.9
LRR [sensitive, ls]	286	309	7.9
LRR [sensitive, ls]	286	309	87
LRR [sensitive, ls]	310	333	0.084
LRR [sensitive, ls]	310	333	0.92
LRR [sensitive, ls]	334	363	1.1
LRR [sensitive, ls]	334	363	12
LRR [sensitive, ls]	364	387	0.00018
LRR [sensitive, ls]	364	387	0.0019
LRR [sensitive, ls]	389	412	1.2
LRR [sensitive, ls]	389	412	13
LRR [sensitive, ls]	413	436	0.0044
LRR [sensitive, ls]	413	436	0.048
LRR [sensitive, ls]	437	460	0.38
LRR [sensitive, ls]	437	460	4.1
LRR [sensitive, ls]	485	509	1
LRR [sensitive, ls]	485	509	11
LRR [sensitive, ls]	510	533	6.7
LRR [sensitive, ls]	510	533	73
LRR [sensitive, ls]	534	557	0.94
LRR [sensitive, ls]	534	557	10
LRR [sensitive, ls]	558	581	0.00085
LRR [sensitive, ls]	558	581	0.0093
LRR [sensitive, ls]	582	605	0.0069
LRR [sensitive, ls]	582	605	0.076
LRR [sensitive, ls]	606	628	2.7
LRR [sensitive, ls]	606	628	29

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	9	830	0
CLV2 [A. thaliana]	43	646	1e-60
FLS2 [A.thaliana]	46	622	2e-86
Cf-9 [L. pimpinellifolium]	64	622	1e-51
Cf-9 [L. pimpinellifolium]	91	527	3e-46
Cf-9 [L. pimpinellifolium]	94	685	4e-55
FLS2 [A.thaliana]	97	647	3e-88
FLS2 [A.thaliana]	97	255	1e-24
FLS2 [A.thaliana]	99	221	3e-11
FLS2 [A.thaliana]	100	1020	1e-137
Cf-9 [L. pimpinellifolium]	205	646	3e-43
FLS2 [A.thaliana]	224	646	7e-45
Rpg1 [Hordeum vulgare]	709	932	4e-25
Pto [L. esculentum]	713	965	2e-24
Rpg1 [Hordeum vulgare]	717	1019	1e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	664	686	out -> in

Report for 3747.m00136

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)