Report for 3747.m00138

 > 3747.m00138, length: 978, copies: 3 

MARSLALLMLLFNSSLLLPPASSDDDAAAAAVPTGGAAADELALLSFRSSLVSQGGSSLASWNTTSGHGQHCTWA

GVACGGRRDRVVELRLRSFNLSGTISPSLGNLSFLAKLHLGGNHLSGEIPPELGRLSRLRRLNMSGNSLQGSIPA

AIGGCFRLIEMDLTINQLEGKIPLQIGASMKNLAYLYLEGNRLSGQIPRSLAELPSIQELSLGSNGLSGEIPPAL

GNLTGLSFLSLSENSLSGGIPSSLCNLTSLSSLYLNKNTLSGTIPSCLGNLNSLLELALSDNTLSGAIPSSLGRL

SRLSSLHLSSNNLSGLIPDPIWNISSLTVFGVQYNMLSGMLPANAFSTLPHLQEVYMDNNQFHGHIPASVANASN

ISMLTFGVNSFSGVVPEEIGRLRNLGTLVLAETLLEAEGPNDWKFMTALTNCSNLQHVEMGACKFGGVLPDSVSN

LSSSLVYLSIGANKISGSLPRDIGNLINLESLVLFNNSLTGSLPSSFSKLKNLHRLILFNNKLSGYLQLTIGNLT

QITNLELYGNAFSGTIPSTLGNMTRLFELNLAHNNFIGAIPTEIFSIPTLSETLDVSHNKLEGSIPKEIGELKNI

VEFHADSNKLSGEIPSTISGCQLLQHLSLQNNFLNGNIPIALTQLAGLDTLDLSGNNLSGQIPKSLGDMPLLHSL

NLSFNSFQGEVPTNGVFANASEIYIQGNANICGGIPELRLPQCSLKSTKKKKHQILLIALTVCLVSTLAIFSLLY

MLLTCHKRRKKEVPAMTSIQGHPMITYKQLVKATDGFSPANLLGSGSFGSVYKGELDSQHGESTSSVAVKVLKLE

TPKAVKSFTAECEALRNMRHRNLVKIVTICSSIDNKGNDFKAIVYDFMPNGSLEDWLHPETNCDQAEQRHLNLHQ

RVNILLDVACALDYLHCLGPESVVHCDIKSSNVLLDADMVAHVGDFGLARILVKESSLMQQSTSSMGFRGTIGYA

APG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	109	132	0.12
LRR [Pfam ls]	133	156	0.036
LRR [Pfam ls]	182	205	0.028
LRR [Pfam ls]	206	229	0.0053
LRR [Pfam ls]	230	253	0.067
LRR [Pfam ls]	254	277	0.52
LRR [Pfam ls]	278	301	2.1
LRR [Pfam ls]	302	325	0.079
LRR [Pfam ls]	326	350	1.6
LRR [Pfam ls]	429	452	5.2
LRR [Pfam ls]	454	477	1.9
LRR [Pfam ls]	478	501	0.0061
LRR [Pfam ls]	502	525	3.5
LRR [Pfam ls]	526	549	0.047
LRR [Pfam ls]	550	574	5.4
LRR [Pfam ls]	647	670	0.0074
Ser/Thr pkinase [Pfam fs]	787	977	1.4e-40
Ser/Thr pkinase [Pfam ls]	787	978	1e-10

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	85	108	3.9
LRR [sensitive, ls]	85	108	43
LRR [sensitive, ls]	109	132	0.011
LRR [sensitive, ls]	109	132	0.12
LRR [sensitive, ls]	133	156	0.0033
LRR [sensitive, ls]	133	156	0.036
LRR [sensitive, ls]	157	181	1.9
LRR [sensitive, ls]	157	181	21
LRR [sensitive, ls]	182	205	0.0026
LRR [sensitive, ls]	182	205	0.028
LRR [sensitive, ls]	206	229	0.00049
LRR [sensitive, ls]	206	229	0.0053
LRR [sensitive, ls]	230	253	0.0062
LRR [sensitive, ls]	230	253	0.067
LRR [sensitive, ls]	254	277	0.048
LRR [sensitive, ls]	254	277	0.52
LRR [sensitive, ls]	278	301	0.19
LRR [sensitive, ls]	278	301	2.1
LRR [sensitive, ls]	302	325	0.0072
LRR [sensitive, ls]	302	325	0.079
LRR [sensitive, ls]	326	350	0.15
LRR [sensitive, ls]	326	350	1.6
LRR [sensitive, ls]	351	374	0.61
LRR [sensitive, ls]	351	374	6.7
LRR [sensitive, ls]	429	452	0.47
LRR [sensitive, ls]	429	452	5.2
LRR [sensitive, ls]	454	477	0.17
LRR [sensitive, ls]	454	477	1.9
LRR [sensitive, ls]	478	501	0.00056
LRR [sensitive, ls]	478	501	0.0061
LRR [sensitive, ls]	502	525	0.32
LRR [sensitive, ls]	502	525	3.5
LRR [sensitive, ls]	526	549	0.0043
LRR [sensitive, ls]	526	549	0.047
LRR [sensitive, ls]	550	574	0.49
LRR [sensitive, ls]	550	574	5.4
LRR [sensitive, ls]	575	598	0.54
LRR [sensitive, ls]	575	598	5.9
LRR [sensitive, ls]	599	622	1.1
LRR [sensitive, ls]	599	622	13
LRR [sensitive, ls]	623	646	0.54
LRR [sensitive, ls]	623	646	6
LRR [sensitive, ls]	647	670	0.00068
LRR [sensitive, ls]	647	670	0.0074
LRR [sensitive, ls]	671	696	0.87
LRR [sensitive, ls]	671	696	9.6

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	7	903	0
CLV2 [A. thaliana]	40	763	1e-65
FLS2 [A.thaliana]	43	712	1e-105
Cf-9 [L. pimpinellifolium]	82	342	1e-23
Cf-9 [L. pimpinellifolium]	86	566	8e-51
FLS2 [A.thaliana]	95	977	1e-133
Cf-9 [L. pimpinellifolium]	104	716	2e-63
Cf-9 [L. pimpinellifolium]	200	712	2e-51
Rpg1 [Hordeum vulgare]	777	977	5e-18
Pto [L. esculentum]	778	977	1e-17
Rpg1 [Hordeum vulgare]	784	977	1e-10

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	730	752	out -> in

Report for 3747.m00138

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)