Report for 3747.m00139

 > 3747.m00139, length: 1035, copies: 3 

MARAMMLLLFCSYALALVSAGSSSSSNATADELALLSFKSMLSSPSLGLMASWNSSSHFCSWTGVSCSRQQPEKV

IALQMNSCGLSGRISPFLGNLSFLKTLDLGNNQLVGQIPSELGHLSKLRMLNLSTNLLRGSIPVEMRGCTKLMTL

HLGNNQLQGEIPAEIGSSLKNLINLYLTRNLLSGEIPQSLAELPSLELLSLSHNKLSGEVPSALSNLTNLLNIRF

SNNMLSGVIPSSLGMLPNLYELSLGFNNLSGPIPTSIWNISSLRALSVQGNMLSGTIPANAFETLPHLEELYMDH

NHLHGKIPVSLGNSSNLSMIILGANLFNGIVPQEIGRLRKLEQLVLTQTLVGAKEQKDWEFITALANCSQLQVLV

LGMCEFGGVLPNSLSSLSTSLKYLSLSYNNILGSIPKDIGNLFNLQVLDLAWNSFIGTLPSSLGRLKNLHYFNVY

NNDLGGPIPSTIGNLTELITLYLMSNTFSGRLTNSLANLTKLTELDLSSNNFIGPIPSGLFNITTLSIALELSYN

KFEGSIPQEIGNLVNLVKFNAESNKLSGEIPSTLGQCQNLQDLTLQNNMLNGNIPEQLSQLKSLQTLDFSRNNLS

GEIPIFIENFTMLSYLNLSFNIFTGEVPTTGIFTNSTAISIQHNGRLCGGITTLHLPPCSSQLPKNKHKPVVIPI

VISLVATLAVLSLLYILFAWHKKIQTEIPSTTSMRGHPLVSYSQLVKATDEFSIANLLGSGSFGSVYKGELVAQI

GESPYYVAVKVLKLQTSGALKSFAAECNALRNLRHRNLVKIITACSSIDNSGNDFKAIVFDFMPNGSLEGWLHPD

KDDQIDHKYLNLLERVGILLDVANALDYLHCHGPTPVVHCDLKPSNVLLDAEMVAHLGDFGLAKILVEGNSLLQQ

STSSMGFRGTIGYAPPEYGAGNTVSTLGDIYSYGILVLEMVTGKRPIDNKSIQGLSLREYVELGLHGKMMDVVDT

QLFLGLENEFQTADDSSCKGRINCLVALLRLGLYCSQEMPSNRMLTGDIIKELSSIKQSL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	98	121	0.024
LRR [Pfam ls]	122	145	0.8
LRR [Pfam ls]	146	170	0.12
LRR [Pfam ls]	171	194	0.31
LRR [Pfam ls]	195	218	0.0011
LRR [Pfam ls]	219	242	1.1
LRR [Pfam ls]	243	266	1.1
LRR [Pfam ls]	267	291	0.0045
LRR [Pfam ls]	292	315	0.31
LRR [Pfam ls]	395	418	0.032
LRR [Pfam ls]	419	442	0.13
LRR [Pfam ls]	443	466	0.12
LRR [Pfam ls]	491	514	0.22
LRR [Pfam ls]	564	587	0.21
LRR [Pfam ls]	588	611	0.022
Ser/Thr pkinase [Pfam fs]	727	946	9.7e-51
Ser/Thr pkinase [Pfam ls]	727	1025	1.4e-40

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	74	97	2
LRR [sensitive, ls]	74	97	22
LRR [sensitive, ls]	98	121	0.0022
LRR [sensitive, ls]	98	121	0.024
LRR [sensitive, ls]	122	145	0.073
LRR [sensitive, ls]	122	145	0.8
LRR [sensitive, ls]	146	170	0.011
LRR [sensitive, ls]	146	170	0.12
LRR [sensitive, ls]	171	194	0.028
LRR [sensitive, ls]	171	194	0.31
LRR [sensitive, ls]	195	218	9.7e-05
LRR [sensitive, ls]	195	218	0.0011
LRR [sensitive, ls]	219	242	0.099
LRR [sensitive, ls]	219	242	1.1
LRR [sensitive, ls]	243	266	0.096
LRR [sensitive, ls]	243	266	1.1
LRR [sensitive, ls]	267	291	0.00041
LRR [sensitive, ls]	267	291	0.0045
LRR [sensitive, ls]	292	315	0.028
LRR [sensitive, ls]	292	315	0.31
LRR [sensitive, ls]	316	339	4
LRR [sensitive, ls]	316	339	43
LRR [sensitive, ls]	370	393	1.7
LRR [sensitive, ls]	370	393	19
LRR [sensitive, ls]	395	418	0.0029
LRR [sensitive, ls]	395	418	0.032
LRR [sensitive, ls]	419	442	0.012
LRR [sensitive, ls]	419	442	0.13
LRR [sensitive, ls]	443	466	0.011
LRR [sensitive, ls]	443	466	0.12
LRR [sensitive, ls]	467	490	2.9
LRR [sensitive, ls]	467	490	32
LRR [sensitive, ls]	491	514	0.02
LRR [sensitive, ls]	491	514	0.22
LRR [sensitive, ls]	516	539	4.8
LRR [sensitive, ls]	516	539	53
LRR [sensitive, ls]	540	563	0.97
LRR [sensitive, ls]	540	563	11
LRR [sensitive, ls]	564	587	0.019
LRR [sensitive, ls]	564	587	0.21
LRR [sensitive, ls]	588	611	0.002
LRR [sensitive, ls]	588	611	0.022
LRR [sensitive, ls]	612	634	2.9
LRR [sensitive, ls]	612	634	32

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	4	841	0
Cf-9 [L. pimpinellifolium]	8	712	6e-59
Cf-9 [L. pimpinellifolium]	14	628	6e-56
CLV2 [A. thaliana]	25	506	2e-44
CLV2 [A. thaliana]	31	625	5e-59
FLS2 [A.thaliana]	34	628	2e-88
FLS2 [A.thaliana]	73	276	1e-25
CLV2 [A. thaliana]	75	439	1e-28
CLV2 [A. thaliana]	78	240	8e-12
FLS2 [A.thaliana]	78	1032	1e-131
CLV2 [A. thaliana]	174	629	6e-47
FLS2 [A.thaliana]	199	644	2e-52
CLV2 [A. thaliana]	247	630	8e-43
FLS2 [A.thaliana]	349	649	1e-37
Rpg1 [Hordeum vulgare]	716	949	6e-24
Pto [L. esculentum]	720	977	6e-22
Rpg1 [Hordeum vulgare]	724	944	7e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	671	693	out -> in

Report for 3747.m00139

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)