Report for 3747.m00140

 > 3747.m00140, length: 1068, copies: 3 

MAGEVAFICLLLVCLCSHSLALSPPPPPPSSPVSSNDATKATVDELALLSIKSMLSSPSSSPLASWNSTSSIHHC

SWPGVVCSRRHPGRVAALRMASFNLSGAISPFLANLSFLRELDLAGNQLAGEIPPEIGRLGRLETVNLAANALQG

TLPLSLGNCTNLMVLNLTSNQLQGEIPSTIGARMVNLYILDLRQNGFSGEIPLSLAELPSLEFLFLYSNKLSGEI

PTALSNLSGLMHLDLDTNMLSGAIPSSLGKLSSLIWLNLANNNLSGTIPSSIWNISSSLWGLNIQQNNLVGVVPT

DAFTALPELRTISMDNNRFHGRLPTSLVNVSHVRMLQLGFNFFSGTVPSELGMLKNLEQFLLFATLLEAKEPRDW

EFITALTNCSRLKILELGASKFGGVLPDSLSNLSTSLQTLSLQYNTISGRIPKDIGNLIGLQSLTLDDNSFIGTL

PSSLGRLQNLNLLSVPKNKISGSVPLAIGNLTKLSSLELQANAFSGEIPSTVANLTKLSALNLARNNFTGAIPRR

LFNILSLSKILDISHNNLEGSIPQEIGNLINLEEFHAQSNILSGEIPPSLGECQLLQNVYLQNNFLNGTISSALG

QLKGLESLDLSNNKLSGQIPRFLGNISMLSYLNLSFNNFSGEVPDFGVFANITAFLIQGNDKLCGGIPTLHLRPC

SSGLPEKKHKFLVIFIVTISAVAILGILLLLYKYLNRRKKNNTKNSSETSMQAHRSISFSQLAKATEGFSATNLL

GSGTFGSVYKGKIDGQTDESAEYIAVKVLKLQTPGAHKSFVAECEALKNLRHRNLVKVITACSSIDTRGYDFKAI

VFDFMPNGSLEDWLHPKPVDQTEMKYLGLVQRVTILLDVAYALDYLHCRGPAPVVHCDIKSSNVLLDSDMVAHVG

DFGLAKILAEGSSSLQHSTSSMGFRGTIGYAAPEYGAGNIVSTNGDIYSYGILVLETVTGKRPTDNRFRQGLSLR

EYVEQALHGETMDIVDSQLTLELENECALQDSSYKRKIDCLISLLRLGVSCSHELPLSRMRTTDIVNELHAMRES

LLREYRIEDGSYVNVTLE

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	113	136	0.062
LRR [Pfam ls]	137	160	2.7
LRR [Pfam ls]	161	185	3.1
LRR [Pfam ls]	186	209	0.49
LRR [Pfam ls]	210	233	0.02
LRR [Pfam ls]	234	257	5.1
LRR [Pfam ls]	258	281	0.21
LRR [Pfam ls]	283	307	2.2
LRR [Pfam ls]	386	409	3.9
LRR [Pfam ls]	411	434	0.097
LRR [Pfam ls]	435	458	1.6
LRR [Pfam ls]	483	506	2.4
LRR [Pfam ls]	507	531	1.1
LRR [Pfam ls]	580	603	5
LRR [Pfam ls]	604	627	0.023
LRR [Pfam ls]	628	650	1.1
Ser/Thr pkinase [Pfam fs]	744	966	5.1e-46
Ser/Thr pkinase [Pfam ls]	744	1046	2.9e-40

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	113	136	0.0057
LRR [sensitive, ls]	113	136	0.062
LRR [sensitive, ls]	137	160	0.24
LRR [sensitive, ls]	137	160	2.7
LRR [sensitive, ls]	161	185	0.28
LRR [sensitive, ls]	161	185	3.1
LRR [sensitive, ls]	186	209	0.044
LRR [sensitive, ls]	186	209	0.49
LRR [sensitive, ls]	210	233	0.0018
LRR [sensitive, ls]	210	233	0.02
LRR [sensitive, ls]	234	257	0.46
LRR [sensitive, ls]	234	257	5.1
LRR [sensitive, ls]	258	281	0.02
LRR [sensitive, ls]	258	281	0.21
LRR [sensitive, ls]	283	307	0.2
LRR [sensitive, ls]	283	307	2.2
LRR [sensitive, ls]	308	331	2.1
LRR [sensitive, ls]	308	331	23
LRR [sensitive, ls]	332	355	1
LRR [sensitive, ls]	332	355	11
LRR [sensitive, ls]	386	409	0.35
LRR [sensitive, ls]	386	409	3.9
LRR [sensitive, ls]	411	434	0.0089
LRR [sensitive, ls]	411	434	0.097
LRR [sensitive, ls]	435	458	0.15
LRR [sensitive, ls]	435	458	1.6
LRR [sensitive, ls]	459	482	0.53
LRR [sensitive, ls]	459	482	5.8
LRR [sensitive, ls]	483	506	0.22
LRR [sensitive, ls]	483	506	2.4
LRR [sensitive, ls]	507	531	0.1
LRR [sensitive, ls]	507	531	1.1
LRR [sensitive, ls]	532	555	0.8
LRR [sensitive, ls]	532	555	8.8
LRR [sensitive, ls]	556	579	0.53
LRR [sensitive, ls]	556	579	5.9
LRR [sensitive, ls]	580	603	0.46
LRR [sensitive, ls]	580	603	5
LRR [sensitive, ls]	604	627	0.0021
LRR [sensitive, ls]	604	627	0.023
LRR [sensitive, ls]	628	650	0.096
LRR [sensitive, ls]	628	650	1.1

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	29	643	3e-62
Xa21 [O. sativa]	32	859	0
FLS2 [A.thaliana]	45	252	3e-23
FLS2 [A.thaliana]	47	644	3e-92
Cf-9 [L. pimpinellifolium]	51	738	9e-53
Cf-9 [L. pimpinellifolium]	62	524	2e-51
CLV2 [A. thaliana]	90	576	2e-40
CLV2 [A. thaliana]	92	355	2e-21
Cf-9 [L. pimpinellifolium]	93	666	2e-52
FLS2 [A.thaliana]	96	645	9e-77
FLS2 [A.thaliana]	100	1059	1e-134
CLV2 [A. thaliana]	197	646	3e-51
FLS2 [A.thaliana]	374	661	2e-38
CLV2 [A. thaliana]	438	669	2e-20
Pto [L. esculentum]	714	1001	1e-23
Rpg1 [Hordeum vulgare]	721	966	9e-25
Rpg1 [Hordeum vulgare]	737	961	5e-16

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	688	710	out -> in

Report for 3747.m00140

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)