Report for 3747.m00145

 > 3747.m00145, length: 1133, copies: 3 

MARATALLCSSLLLLSCFYAQVSPGSSSSSRSTAMADEPALLSFKSMLLSDGFLASWNASSHYCSWPGVVCGGRH

PERVVALQMSSFNLSGRISPSLGNLSLLRELELGDNQFTGDIPPEIGQLTRLRMLNLSSNYLQGSIPASIGECAE

LMSIDLGNNQLQGEIPAELGALKNLVRLGLHENALSGEIPRSLADLQSLGALSLFKNRLHGEIPPGLGNLTNLYH

LLLAHNMLSGAIPSSLGMLSGLSWLELGFNNLTGLIPSSIWNVSSLTELNLQQNMLHGTMPPDVFNSLPHLQHLY

INDNQFHGNIPVSIGNVSALSRIQIGFNSFGGIIPPEVGRLRNLTSLEAEHTFLEAKDQKGWGFISALTNCSKLQ

ALFLGNNRFEGVLPVSISNLSVYLEYLYLDFNAISGSLPEEIGNLVRLEALLLHNNSFTGILPSSLGRLKNLQVL

YIDNNKISGSIPLAIGNLTELNYFRLDVNAFTGRIPSALGNLTNLVELGLSSNNFTGSIPVEIFKIHTLSLTLDI

SNNNLEGSIPQEIGGLKNLVQFYADSNKLSGEIPSTLGECQLLQNISLQNNFLSGSVPSLLSQLKGLQILDLSNN

NLSGQIPTFLSNLTMLSYLNLSFNDFSGEVPTFGVFSNPSAISIHGNGKLCGGIPDLHLPRCSSQSPHRRQKLLV

IPIVVSLAVTLLLLLLLYKLLYWRKNIKTNIPSTTSMEGHPLISHSQLVRATDNFSATNLLGSGSFGSVYKGEIN

NQAGESKDIAVKVLKLQTPGALKSFIAECEALRNLWHRNLVKIITACSSIDNSGNDFKAIVFEFMPNGSLDGWLH

PDNNDHTEQRYLNILERVSILLDVAYALDYLHCHGPAPVIHCDIKSSNVLLDSDMVARVGDFGLARILDEQNSVF

QPSTNSILFRGTIGYAAPGVAGEPDRPQCSEVSAHPCSRRRQDTGSDAERCMRHARSASSGWWPATVRTLSCGHD

FHEDCNIAKWLRDNKKACPVHSACNIQLYEYGAGNTVSTQGDIYSYGILVLETVTGKRPSDSEFTQGLSLCESVS

LGLHGKVMDIVDNKLCLGIDQHDPETTDDFSSKQKIDCLISLLRLGLSCSQEMPSSRLSTGDIIKELHAIKESLL

LEIEDTEK

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	102	125	0.021
LRR [Pfam ls]	126	149	0.28
LRR [Pfam ls]	150	173	0.47
LRR [Pfam ls]	174	197	0.59
LRR [Pfam ls]	198	221	2.9
LRR [Pfam ls]	222	245	2.8
LRR [Pfam ls]	246	269	0.45
LRR [Pfam ls]	270	294	0.0012
LRR [Pfam ls]	295	318	1.6
LRR [Pfam ls]	373	396	0.41
LRR [Pfam ls]	398	421	0.14
LRR [Pfam ls]	422	445	0.078
LRR [Pfam ls]	446	469	0.0015
LRR [Pfam ls]	494	518	0.06
LRR [Pfam ls]	567	590	2.6
LRR [Pfam ls]	591	614	0.0031
LRR [Pfam ls]	615	637	3.4
Ser/Thr pkinase [Pfam fs]	730	918	1.1e-36
Ser/Thr pkinase [Pfam ls]	730	1126	9.3e-34

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	102	125	0.0019
LRR [sensitive, ls]	102	125	0.021
LRR [sensitive, ls]	126	149	0.026
LRR [sensitive, ls]	126	149	0.28
LRR [sensitive, ls]	150	173	0.043
LRR [sensitive, ls]	150	173	0.47
LRR [sensitive, ls]	174	197	0.054
LRR [sensitive, ls]	174	197	0.59
LRR [sensitive, ls]	198	221	0.27
LRR [sensitive, ls]	198	221	2.9
LRR [sensitive, ls]	222	245	0.26
LRR [sensitive, ls]	222	245	2.8
LRR [sensitive, ls]	246	269	0.041
LRR [sensitive, ls]	246	269	0.45
LRR [sensitive, ls]	270	294	0.00011
LRR [sensitive, ls]	270	294	0.0012
LRR [sensitive, ls]	295	318	0.14
LRR [sensitive, ls]	295	318	1.6
LRR [sensitive, ls]	319	342	6.7
LRR [sensitive, ls]	319	342	74
LRR [sensitive, ls]	343	372	5.7
LRR [sensitive, ls]	343	372	62
LRR [sensitive, ls]	373	396	0.038
LRR [sensitive, ls]	373	396	0.41
LRR [sensitive, ls]	398	421	0.012
LRR [sensitive, ls]	398	421	0.14
LRR [sensitive, ls]	422	445	0.0071
LRR [sensitive, ls]	422	445	0.078
LRR [sensitive, ls]	446	469	0.00014
LRR [sensitive, ls]	446	469	0.0015
LRR [sensitive, ls]	470	493	0.89
LRR [sensitive, ls]	470	493	9.7
LRR [sensitive, ls]	494	518	0.0054
LRR [sensitive, ls]	494	518	0.06
LRR [sensitive, ls]	519	542	0.58
LRR [sensitive, ls]	519	542	6.3
LRR [sensitive, ls]	543	566	1.5
LRR [sensitive, ls]	543	566	16
LRR [sensitive, ls]	567	590	0.24
LRR [sensitive, ls]	567	590	2.6
LRR [sensitive, ls]	591	614	0.00028
LRR [sensitive, ls]	591	614	0.0031
LRR [sensitive, ls]	615	637	0.31
LRR [sensitive, ls]	615	637	3.4

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	12	844	0
CLV2 [A. thaliana]	37	655	8e-67
FLS2 [A.thaliana]	40	631	2e-97
Cf-9 [L. pimpinellifolium]	56	715	5e-62
FLS2 [A.thaliana]	77	348	5e-37
FLS2 [A.thaliana]	82	462	5e-46
FLS2 [A.thaliana]	89	921	1e-131
FLS2 [A.thaliana]	362	632	8e-33
Pto [L. esculentum]	723	918	3e-15
Rpg1 [Hordeum vulgare]	723	923	6e-19
Rpg1 [Hordeum vulgare]	727	918	2e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	674	696	out -> in

Report for 3747.m00145

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)