Report for 3747.m00152

 > 3747.m00152, length: 645, copies: 3 

MDPTQKFLLFLLVGVAATLSLATNSPVPQWPASCTPREREALLAFKRGITGDPAGRLTSWKRGSHDCCQWRGVRC

SNLTGHVLELHLRNNFPRYDEATALVGHISTSLISLEHLEHLDLSNNNLVGPAGRFPRFVSSLRNLIYINFSGMP

LTGMVPPQLGNITKLQYLDLSHGIGMYSTDIQWLTNLPALRYLGLSNVNLSRVSDWPRVVNMNSYLIVLDLSGCS

LTSASQSFSQLNLTRLEKLDLSYNNFNQPLASCWFWNLTSLTYLDLIMNILPGQFPDSLGDMKALQVFRFSSNGH

SIIMPNLLQNLCNLEILDLGGLSSCNITELLDSLMHCLTKRIRKLYLWDNNITGTLPTGVGKFTSLDTLDLSHNQ

LTGSVPYEISMLTSLAKIDLSLNNLTGEITEEHLAGLKSLKSLNLYYNPYLKIVLGDEWLPPFRLEVARFGSCQL

GPMFPSWLQWMVNIKELDIWSTGITDQLPHWFWTTFSKATDLVISSNNISGSLPANMETMSLERLYLGSNQITGV

IPILPPNLTWLEIQNNMLSGSVASKTFGSAPQLGFMDLSSNNIKGHIPGSICELQHLQYLNLANNHLEGEFPQCI

GMTELQHFILNNNSLSGKVPSFLKGCKQLKYLDLSQNKFHGRLPS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	113	139	0.035
LRR [Pfam ls]	215	237	0.86
LRR [Pfam ls]	240	264	0.59
LRR [Pfam ls]	341	364	0.51
LRR [Pfam ls]	365	388	0.062
LRR [Pfam ls]	389	413	1.1
LRR [Pfam ls]	414	439	5.2
LRR [Pfam ls]	511	530	1.5
LRR [Pfam ls]	532	556	0.092
LRR [Pfam ls]	557	580	4.4
LRR [Pfam ls]	581	603	0.077
LRR [Pfam ls]	604	627	1.3

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	113	139	0.0032
LRR [sensitive, ls]	113	139	0.035
LRR [sensitive, ls]	140	163	0.82
LRR [sensitive, ls]	140	163	8.9
LRR [sensitive, ls]	164	188	2.9
LRR [sensitive, ls]	164	188	32
LRR [sensitive, ls]	189	211	6
LRR [sensitive, ls]	189	211	65
LRR [sensitive, ls]	215	237	0.079
LRR [sensitive, ls]	215	237	0.86
LRR [sensitive, ls]	240	264	0.054
LRR [sensitive, ls]	240	264	0.59
LRR [sensitive, ls]	265	288	6.6
LRR [sensitive, ls]	265	288	72
LRR [sensitive, ls]	313	339	5.6
LRR [sensitive, ls]	313	339	62
LRR [sensitive, ls]	341	364	0.047
LRR [sensitive, ls]	341	364	0.51
LRR [sensitive, ls]	365	388	0.0056
LRR [sensitive, ls]	365	388	0.062
LRR [sensitive, ls]	389	413	0.1
LRR [sensitive, ls]	389	413	1.1
LRR [sensitive, ls]	414	439	0.47
LRR [sensitive, ls]	414	439	5.2
LRR [sensitive, ls]	463	487	1.7
LRR [sensitive, ls]	463	487	19
LRR [sensitive, ls]	488	508	2
LRR [sensitive, ls]	488	508	22
LRR [sensitive, ls]	511	530	0.14
LRR [sensitive, ls]	511	530	1.5
LRR [sensitive, ls]	532	556	0.0084
LRR [sensitive, ls]	532	556	0.092
LRR [sensitive, ls]	557	580	0.4
LRR [sensitive, ls]	557	580	4.4
LRR [sensitive, ls]	581	603	0.007
LRR [sensitive, ls]	581	603	0.077
LRR [sensitive, ls]	604	627	0.12
LRR [sensitive, ls]	604	627	1.3

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	4	644	1e-54
CLV2 [A. thaliana]	7	641	7e-47
Cf-9 [L. pimpinellifolium]	8	644	1e-42
Xa21 [O. sativa]	41	620	6e-40
FLS2 [A.thaliana]	72	644	1e-42
Cf-9 [L. pimpinellifolium]	76	644	2e-32
FLS2 [A.thaliana]	100	598	2e-33
CLV2 [A. thaliana]	117	411	8e-17
CLV2 [A. thaliana]	201	645	4e-38
Cf-9 [L. pimpinellifolium]	216	645	2e-18
Xa21 [O. sativa]	296	644	5e-20

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 3747.m00152

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)