Report for 3747.m00154

 > 3747.m00154, length: 673, copies: 3 

MHPKSSLLFFLMIGALLTNAMANHAPAPAAVNCVPREREALLAFKRGITGDPAGRLASWKEDDHDCCRWRGVRCS

DNLIGHVLELHLQSNLTGVVYVDYSPLEFNAVALVGRITSSLLSLEHLEHLDLSNNNLTGPDGRFPVFVASLRNL

QYLDLSGLGFTGMVPYQLGNLSKLEFLDLSGTGMQSADISWLTRLQWLKYLYLSSVNLSAISDWAHVVNKIPSLT

VLSLSGCSLTRVDHSLKHVNLTRLEKLHLSGNDFSHPLSSCWFWILKTLIYLDLESTGLYGRFPNAITNMTSLQV

LDFSRNNNAGILEPILLRNLCNLESLNLQLGLLSGNMTELLESLSHCSPNKLRKLYLSNNNITGTLPAQSMGQFT

SLANIGFSFNQLTGHVPPEIGKLASLTHLDLSENKLTGTITDEHFGGLVSLTYIDLSYNKLKIVIDPEWLPPFRL

ETAYFASCQMGPLFPAWLRWSSDIDMIDISSANIIDEFPDWVSTAFSKAIYLDMSNNKISGNLPKNMKIMSLEEL

YLNSNRIIGEVPTLPTNLTYLDISNNILSGLVASNFGAPRLDTMNLSSNSIQGQIPSSICRLKYLSTLDLSNNLL

NGKLPRCIGMRNLQKLLLSNNNLSGTFPSLLQGCTLLRYIDLSWNRFYGRLPSWIGDFQELVSLQLRNNTFSW

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	122	144	0.0056
LRR [Pfam ls]	149	172	0.23
LRR [Pfam ls]	173	196	4.8
LRR [Pfam ls]	223	245	0.24
LRR [Pfam ls]	248	272	3
LRR [Pfam ls]	351	375	0.00087
LRR [Pfam ls]	400	424	0.0014
LRR [Pfam ls]	425	449	0.078
LRR [Pfam ls]	542	562	0.36
LRR [Pfam ls]	565	588	0.86
LRR [Pfam ls]	589	611	3.5
LRR [Pfam ls]	612	635	0.0042

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	122	144	0.00051
LRR [sensitive, ls]	122	144	0.0056
LRR [sensitive, ls]	149	172	0.021
LRR [sensitive, ls]	149	172	0.23
LRR [sensitive, ls]	173	196	0.44
LRR [sensitive, ls]	173	196	4.8
LRR [sensitive, ls]	223	245	0.022
LRR [sensitive, ls]	223	245	0.24
LRR [sensitive, ls]	248	272	0.27
LRR [sensitive, ls]	248	272	3
LRR [sensitive, ls]	273	296	1.3
LRR [sensitive, ls]	273	296	14
LRR [sensitive, ls]	322	345	6.7
LRR [sensitive, ls]	322	345	74
LRR [sensitive, ls]	351	375	7.9e-05
LRR [sensitive, ls]	351	375	0.00087
LRR [sensitive, ls]	376	399	0.7
LRR [sensitive, ls]	376	399	7.7
LRR [sensitive, ls]	400	424	0.00013
LRR [sensitive, ls]	400	424	0.0014
LRR [sensitive, ls]	425	449	0.0071
LRR [sensitive, ls]	425	449	0.078
LRR [sensitive, ls]	498	518	0.61
LRR [sensitive, ls]	498	518	6.7
LRR [sensitive, ls]	521	541	1.4
LRR [sensitive, ls]	521	541	15
LRR [sensitive, ls]	542	562	0.033
LRR [sensitive, ls]	542	562	0.36
LRR [sensitive, ls]	565	588	0.079
LRR [sensitive, ls]	565	588	0.86
LRR [sensitive, ls]	589	611	0.32
LRR [sensitive, ls]	589	611	3.5
LRR [sensitive, ls]	612	635	0.00038
LRR [sensitive, ls]	612	635	0.0042
LRR [sensitive, ls]	636	659	0.84
LRR [sensitive, ls]	636	659	9.2

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	35	623	2e-41
FLS2 [A.thaliana]	37	672	3e-43
Xa21 [O. sativa]	40	636	3e-44
Cf-9 [L. pimpinellifolium]	55	661	2e-45
FLS2 [A.thaliana]	76	628	8e-44
Cf-9 [L. pimpinellifolium]	84	652	1e-31
FLS2 [A.thaliana]	100	417	3e-22
CLV2 [A. thaliana]	102	585	1e-27
Cf-9 [L. pimpinellifolium]	109	606	5e-30
FLS2 [A.thaliana]	109	672	5e-51
CLV2 [A. thaliana]	209	673	1e-44
Xa21 [O. sativa]	248	669	7e-31
Xa21 [O. sativa]	274	671	2e-28
Xa21 [O. sativa]	306	672	1e-22
Cf-9 [L. pimpinellifolium]	350	672	2e-21
Xa21 [O. sativa]	502	672	4e-19
Xa21 [O. sativa]	524	672	3e-13
Xa21 [O. sativa]	540	672	7e-12
Xa21 [O. sativa]	555	672	2e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 3747.m00154

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)