Report for 3747.m00156

 > 3747.m00156, length: 383, copies: 2 

MVTLILSFNNLSGHIPESFCRMEQLAALDLANNLFEGELPQCFGMTGMAIVLLQNNRFSGSFPVFLERSTKLQLV

DLSRNNFSGKLPTWIGDKKELVLLLLSHNVFSGIIPINITNLSNLRQLNLAGNSLSGNIPWRLSNLEAMKEDNYI

FNLDIPDDSSYNNLSVFTKRTELFYGPNIFSAVNIDLSSNYLVGQIPEEIASLALLKNLNLSRNYLSGKIPQKIG

SLWSLESLDLSRNKLSGEIPPSLSNLSYLSDLDLSHNNLSGRIPSGSQLDTLYFEHPDMYSSNDGLFGFPLQRNY

SEGIAPKQGYHDHSKTRQVAEPMFFYLGLVSGFVVGLWVVFCTILFKKTWRIAYFSLFDKACDKIYVFTVVTWAR

VSQKTNVQ

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	24	46	4
LRR [Pfam ls]	71	94	3.8
LRR [Pfam ls]	119	142	0.023
LRR [Pfam ls]	205	228	1.7
LRR [Pfam fs]	229	252	1.2e-05
LRR [Pfam ls]	229	252	0.00018
LRR [Pfam ls]	253	275	1.2

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	1	23	6.3
LRR [sensitive, ls]	1	23	69
LRR [sensitive, ls]	24	46	0.36
LRR [sensitive, ls]	24	46	4
LRR [sensitive, ls]	71	94	0.34
LRR [sensitive, ls]	71	94	3.8
LRR [sensitive, ls]	95	118	0.51
LRR [sensitive, ls]	95	118	5.6
LRR [sensitive, ls]	119	142	0.0021
LRR [sensitive, ls]	119	142	0.023
LRR [sensitive, ls]	181	204	1.2
LRR [sensitive, ls]	181	204	13
LRR [sensitive, ls]	205	228	0.16
LRR [sensitive, ls]	205	228	1.7
LRR [sensitive, ls]	229	252	1.7e-05
LRR [sensitive, ls]	229	252	0.00018
LRR [sensitive, ls]	253	275	0.11
LRR [sensitive, ls]	253	275	1.2

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	1	365	1e-41
Cf-9 [L. pimpinellifolium]	1	270	2e-21
Cf-9 [L. pimpinellifolium]	1	284	3e-20
CLV2 [A. thaliana]	1	270	4e-35
CLV2 [A. thaliana]	1	269	4e-25
CLV2 [A. thaliana]	1	225	1e-16
FLS2 [A.thaliana]	1	277	2e-24
Xa21 [O. sativa]	1	269	3e-27
Xa21 [O. sativa]	1	269	3e-20
Xa21 [O. sativa]	1	165	1e-14
Xa21 [O. sativa]	3	270	3e-27
Cf-9 [L. pimpinellifolium]	4	269	2e-27
Cf-9 [L. pimpinellifolium]	4	268	8e-17
CLV2 [A. thaliana]	4	268	7e-31
CLV2 [A. thaliana]	4	278	3e-27
FLS2 [A.thaliana]	4	271	2e-32
FLS2 [A.thaliana]	4	268	4e-28
Xa21 [O. sativa]	4	135	2e-12
CLV2 [A. thaliana]	7	269	8e-28
FLS2 [A.thaliana]	9	269	3e-34
FLS2 [A.thaliana]	9	269	5e-30
Xa21 [O. sativa]	13	270	6e-29
Cf-9 [L. pimpinellifolium]	22	270	2e-17
Cf-9 [L. pimpinellifolium]	42	269	3e-12
CLV2 [A. thaliana]	42	270	2e-20
FLS2 [A.thaliana]	51	270	9e-27
Xa21 [O. sativa]	84	272	2e-17
Xa21 [O. sativa]	185	279	1e-15

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	324	346	out -> in

Report for 3747.m00156

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)