Report for 3751.m00176

 > 3751.m00176, length: 1099, copies: 1 

MLVLAFILFLNLRLPFCLSAQFHNESNADRQALLCLKSQLHDPSGALGSWRNDSSVSMCDWHGVTCSTGLPARVD

GLDLESENITGQIFPCVANLSFISRIHMPGNQLNGHISPEIGRLTHLRYLNLSVNALSGEIPETLSSCSRLETIN

LYSNSIEGKIPPSLAHCSFLQQIILSNNHIHGSIPSEIGLLPNLSALFIPNNELTGTIPPLLGSSKTLVWVNLQN

NSLVGEIPPSLFNSSTITYIDLSQNGLSGTIPPFSKTSLVLRYLCLTNNYISGEIPNSIDNILSLSKLMLSGNNL

EGTIPESLGKLSNLQLLDLSYNNLSGIISPGIFKISNLTYLNFGDNRFVGRIPTNIGYTLPRLTSFILHGNQFEG

PIPATLANALNLTEIYFGRNSFTGIIPSLGSLSMLTDLDLGDNKLESGDWTFMSSLTNCTQLQNLWLGGNNLQGV

LPTSIGNLSKGLQILNLVQNQLTGSIPSEIENLTGLTAILMGNNMLSGQIPSTIANLPNLLILSLSHNKLSGEIP

RSIGTLEQLIELYLQENELTGQIPSSLARCTNLVELNISRNNLNGSIPLDLFSISTLSKGLDISYNQLTGHIPLE

IGRLINLNSLNISNNQLSGEIPSNLGECLVLESVRLEANFLQGGIPESLINLRGIIEIDFSQNNLSGEIPKYFES

FGSLRSLNLSFNNLEGPVPKGGVFANSSDVFIQGNKMLCASSPMLQLPLCKELSAKRKTSYILTVVVPVSTIVMI

TLACVAIMFLKKRSGPERIGINHSFRRLDKISYSDLYKATYGFSSTSLVGSGTFGLVYKGQLKFGARDVAIKVFR

LDQNGAPNSFFAECEALKNIRHRNLVRVIGLCSTFDPSGNEFKALILEYRANGNLESWIHPKPCSQSPPKLFSLA

SRVRVAGDIATALDYLHNRCTPSLVHCDLKPSNVLLDDEMVACISDFGLAKFLHNNFISLNNSSSTTGLRGSIGY

IAPEYGLGCKVSAEGDVYSYGIIVLEMITGKQPTDEIFQDGMDLHNFVESAFPDQISDILDPTITEYCEGEDPNH

VVPEILTCAIQMAKLGLMCTETSPKDRPTMDDVYYDIISIKEKYYALIN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	121	144	0.07
LRR [Pfam ls]	145	168	0.019
LRR [Pfam ls]	169	192	0.26
LRR [Pfam ls]	193	216	2.2
LRR [Pfam ls]	217	240	1.6
LRR [Pfam ls]	241	263	0.046
LRR [Pfam ls]	289	312	0.016
LRR [Pfam ls]	313	334	0.031
LRR [Pfam ls]	337	361	2
LRR [Pfam ls]	386	408	0.16
LRR [Pfam ls]	436	459	0.041
LRR [Pfam ls]	461	484	0.038
LRR [Pfam ls]	509	532	0.1
LRR [Pfam ls]	533	556	0.35
LRR [Pfam ls]	557	581	0.028
LRR [Pfam ls]	606	629	0.16
LRR [Pfam ls]	654	677	5.2
LRR [Pfam ls]	678	703	0.38
Ser/Thr pkinase [Pfam fs]	793	1011	9.5e-53
Ser/Thr pkinase [Pfam ls]	793	1085	5.6e-50

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	97	120	2.6
LRR [sensitive, ls]	97	120	29
LRR [sensitive, ls]	121	144	0.0064
LRR [sensitive, ls]	121	144	0.07
LRR [sensitive, ls]	145	168	0.0017
LRR [sensitive, ls]	145	168	0.019
LRR [sensitive, ls]	169	192	0.024
LRR [sensitive, ls]	169	192	0.26
LRR [sensitive, ls]	193	216	0.2
LRR [sensitive, ls]	193	216	2.2
LRR [sensitive, ls]	217	240	0.15
LRR [sensitive, ls]	217	240	1.6
LRR [sensitive, ls]	241	263	0.0042
LRR [sensitive, ls]	241	263	0.046
LRR [sensitive, ls]	265	288	0.53
LRR [sensitive, ls]	265	288	5.8
LRR [sensitive, ls]	289	312	0.0014
LRR [sensitive, ls]	289	312	0.016
LRR [sensitive, ls]	313	334	0.0028
LRR [sensitive, ls]	313	334	0.031
LRR [sensitive, ls]	337	361	0.18
LRR [sensitive, ls]	337	361	2
LRR [sensitive, ls]	362	385	0.98
LRR [sensitive, ls]	362	385	11
LRR [sensitive, ls]	386	408	0.015
LRR [sensitive, ls]	386	408	0.16
LRR [sensitive, ls]	409	435	1.2
LRR [sensitive, ls]	409	435	13
LRR [sensitive, ls]	436	459	0.0038
LRR [sensitive, ls]	436	459	0.041
LRR [sensitive, ls]	461	484	0.0035
LRR [sensitive, ls]	461	484	0.038
LRR [sensitive, ls]	485	508	0.55
LRR [sensitive, ls]	485	508	6
LRR [sensitive, ls]	509	532	0.0095
LRR [sensitive, ls]	509	532	0.1
LRR [sensitive, ls]	533	556	0.032
LRR [sensitive, ls]	533	556	0.35
LRR [sensitive, ls]	557	581	0.0025
LRR [sensitive, ls]	557	581	0.028
LRR [sensitive, ls]	582	605	5.6
LRR [sensitive, ls]	582	605	61
LRR [sensitive, ls]	606	629	0.015
LRR [sensitive, ls]	606	629	0.16
LRR [sensitive, ls]	630	653	0.98
LRR [sensitive, ls]	630	653	11
LRR [sensitive, ls]	654	677	0.48
LRR [sensitive, ls]	654	677	5.2
LRR [sensitive, ls]	678	703	0.035
LRR [sensitive, ls]	678	703	0.38

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	6	718	2e-64
FLS2 [A.thaliana]	31	1093	1e-155
Cf-9 [L. pimpinellifolium]	49	759	2e-63
CLV2 [A. thaliana]	77	580	1e-43
Xa21 [O. sativa]	145	903	1e-154
FLS2 [A.thaliana]	385	705	3e-42
Rpg1 [Hordeum vulgare]	744	1090	2e-30
Pto [L. esculentum]	785	1087	3e-29
Rpg1 [Hordeum vulgare]	786	1083	2e-19

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	738	760	out -> in
putative TM domain	786	808	in -> out

Report for 3751.m00176

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)