Report for 3764.m00174

 > 3764.m00174, length: 443, copies: 1 

MRMILGRLLVVAVLAAAAAAAESEPRLPAAEQEGVYAVLEAVNPGFPWRASFPDDLCLAGPHGVSCDDDDGGNAS

HVVGISLGYVSDFSANPSCAXPFAXTLLTSGLLAASFPRLRSLFVYGCFVGDDDARPLPPLPWRLPPTLQDLVLV

NNPALTGRLAISAASLPLLRRLVVASSGLSGDLPSTPFPRLEQLVLSGSRFAGRIPSALVQGLANVKILDLSSNL

LAGGIPRAIGGLTQLVKLDLSSNTLAGPIPGELGGLASLELLDLSNNRLTGGVPAALRGMTAIREMYLSGNRRLG

GRVPADMFAGLKGISAVGLSDAGLTGTIPASLGESLRNVTYLGLDGNLLEGEVPPALAKMAGRVRLHGNRAVCIS

PEFLAGAPRPRIAGVPSCNATQAAPVTRRPVVMPVPLASAEKPAAAAPPPPMRIGSCVVVAMLLLMLS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	190	214	5.8
LRR [Pfam ls]	215	238	0.088
LRR [Pfam ls]	239	262	0.7
LRR [Pfam fs]	263	286	3.3e-05
LRR [Pfam ls]	263	286	0.00055
LRR [Pfam ls]	287	312	0.63
LRR [Pfam ls]	338	361	1.2

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	114	137	1.9
LRR [sensitive, ls]	114	137	44
LRR [sensitive, ls]	143	170	2.7
LRR [sensitive, ls]	143	170	62
LRR [sensitive, ls]	190	214	0.25
LRR [sensitive, ls]	190	214	5.8
LRR [sensitive, ls]	215	238	0.0038
LRR [sensitive, ls]	215	238	0.088
LRR [sensitive, ls]	239	262	0.03
LRR [sensitive, ls]	239	262	0.7
LRR [sensitive, ls]	263	286	2.4e-05
LRR [sensitive, ls]	263	286	0.00055
LRR [sensitive, ls]	287	312	0.027
LRR [sensitive, ls]	287	312	0.63
LRR [sensitive, ls]	313	337	3
LRR [sensitive, ls]	313	337	71
LRR [sensitive, ls]	338	361	0.05
LRR [sensitive, ls]	338	361	1.2

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	105	321	8e-15
Cf-9 [L. pimpinellifolium]	134	360	3e-15
CLV2 [A. thaliana]	143	354	3e-13
FLS2 [A.thaliana]	143	360	1e-17
Xa21 [O. sativa]	143	366	1e-12
Xa21 [O. sativa]	144	373	2e-19
Xa21 [O. sativa]	144	366	6e-19
FLS2 [A.thaliana]	146	380	1e-21
FLS2 [A.thaliana]	146	361	2e-15
FLS2 [A.thaliana]	147	361	7e-19
CLV2 [A. thaliana]	154	392	2e-13
CLV2 [A. thaliana]	155	332	7e-16
FLS2 [A.thaliana]	155	376	6e-22
FLS2 [A.thaliana]	155	379	8e-22
FLS2 [A.thaliana]	156	360	8e-22
Xa21 [O. sativa]	190	354	4e-17
Xa21 [O. sativa]	191	369	8e-16
Cf-9 [L. pimpinellifolium]	196	279	1e-11
CLV2 [A. thaliana]	219	393	7e-13

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 3764.m00174

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)