Report for 3770.m00253

 > 3770.m00253, length: 1022, copies: 1 

MSNTYLPLLPALVAGVLLLAAGCAAAAGDRDTLVAIRKGWGNPRHLASWDPASAAAADHCSWEGVTCSNATTGGG

GGAGVVTELSLHDMNLTGTVPTAVCDLASLTRLDLSNNQLTGAFPAAALSRCARLRFLDLANNALDGALPQHVGR

LSPAMEHLNLSSNRLSGAVPPEVAALPALRSLLLDTNRFTGAYPAAEIANLTALERLTLADNGFAPAPVPPAFAK

LTKLTYLWMSKMNITGEIPEAFSSLTELTLLDMSGNKLTGAIPAWVFRHQKLERLYLYENSLSGELPRNVTTANL

VEIDLSSNQLGGEISEDFGNLKNLSLLFLYFNKVTGAIPASIGRLPNLTDLRLFGNELSGELPPELGKNSPLANF

EVSNNNLSGALPETLCANGKLFDIVVFNNSFSGELPANLGDCVLLNNLMLYNNRFTGDFPEKIWSFQKLTTVMIQ

NNGFTGALPAEISTNISRIEMGNNMFSGSIPTSATKLTVFRAENNLLAGELPADMSNLTDLTDFSVPGNRISGSI

PASIRLLVKLNSLNLSSNRISGVIPPASFGTLPALTILDLSGNELTGDIPADLGYLNFNSLNVSSNRLTGEVPLT

LQGAAYDRSFLGNSLCARPGSGTNLPTCPGGGGGGGGHDELSKGLIVLFSMLAGIVLVGSAGIAWLLLRRRKDSQ

DVTDWKMTQFTPLDFAESDVLGNIREENVIGSGGSGKDGGREEIWNARKLDAKLDKEFKAEVTVLGNIRHNNIVK

LLCCISSQDAKLLVYEYMENGSLDRWLHHRDRDGAPAPLDWPTRLAIAVDAARGLSYMHHDCAQAIVHRDVKSSN

ILLDPEFQAKIADFGLARMLVKSGEPESVSAIGGTFGYMAPEYGYSKRVNEKVDVYSFGVVLLELTTGKVANDAA

ADFCLAEWAWRRYQKGPPFDDVIDADIREQASLPDIMSVFTLGVICTGENPPARPSMKEVLHHLIRCDRMSAQGP

EACQLDYVDGAAPLLEAKKGSRRRSSESGRWDDDDDDDSGNFVVHVV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	104	128	0.012
LRR [Pfam ls]	129	152	1.9
LRR [Pfam ls]	154	177	0.59
LRR [Pfam ls]	228	251	0.16
LRR [Pfam ls]	252	275	3.5
LRR [Pfam ls]	276	296	1.2
LRR [Pfam ls]	299	322	0.0029
LRR [Pfam ls]	323	346	0.97
LRR [Pfam ls]	347	371	0.043
LRR [Pfam ls]	534	558	0.0013
LRR [Pfam ls]	559	579	0.24
Ser/Thr pkinase [Pfam ls]	699	966	9.9e-38
Ser/Thr pkinase [Pfam fs]	724	900	3.7e-41

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	80	103	2
LRR [sensitive, ls]	80	103	47
LRR [sensitive, ls]	104	128	0.0005
LRR [sensitive, ls]	104	128	0.012
LRR [sensitive, ls]	129	152	0.08
LRR [sensitive, ls]	129	152	1.9
LRR [sensitive, ls]	154	177	0.025
LRR [sensitive, ls]	154	177	0.59
LRR [sensitive, ls]	178	202	1.6
LRR [sensitive, ls]	178	202	36
LRR [sensitive, ls]	203	227	0.5
LRR [sensitive, ls]	203	227	12
LRR [sensitive, ls]	228	251	0.0067
LRR [sensitive, ls]	228	251	0.16
LRR [sensitive, ls]	252	275	0.15
LRR [sensitive, ls]	252	275	3.5
LRR [sensitive, ls]	276	296	0.05
LRR [sensitive, ls]	276	296	1.2
LRR [sensitive, ls]	299	322	0.00013
LRR [sensitive, ls]	299	322	0.0029
LRR [sensitive, ls]	323	346	0.042
LRR [sensitive, ls]	323	346	0.97
LRR [sensitive, ls]	347	371	0.0018
LRR [sensitive, ls]	347	371	0.043
LRR [sensitive, ls]	395	418	4.3
LRR [sensitive, ls]	395	418	100
LRR [sensitive, ls]	419	442	0.68
LRR [sensitive, ls]	419	442	16
LRR [sensitive, ls]	443	467	0.89
LRR [sensitive, ls]	443	467	21
LRR [sensitive, ls]	486	509	0.56
LRR [sensitive, ls]	486	509	13
LRR [sensitive, ls]	510	533	1.8
LRR [sensitive, ls]	510	533	41
LRR [sensitive, ls]	534	558	5.5e-05
LRR [sensitive, ls]	534	558	0.0013
LRR [sensitive, ls]	559	579	0.011
LRR [sensitive, ls]	559	579	0.24
LRR [sensitive, ls]	582	605	0.58
LRR [sensitive, ls]	582	605	14

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	22	785	2e-73
Cf-9 [L. pimpinellifolium]	43	602	3e-45
CLV2 [A. thaliana]	44	621	5e-48
FLS2 [A.thaliana]	59	610	2e-67
FLS2 [A.thaliana]	80	308	2e-22
Cf-9 [L. pimpinellifolium]	81	613	1e-50
Cf-9 [L. pimpinellifolium]	81	408	2e-23
Cf-9 [L. pimpinellifolium]	83	578	5e-42
FLS2 [A.thaliana]	90	966	1e-105
Cf-9 [L. pimpinellifolium]	196	606	8e-32
FLS2 [A.thaliana]	324	601	2e-24
Pto [L. esculentum]	687	964	6e-33
Rpg1 [Hordeum vulgare]	701	964	5e-20
Rpg1 [Hordeum vulgare]	730	968	6e-19

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	5	27	in -> out
putative TM domain	5	27	in -> out
putative TM domain	646	668	out -> in
putative TM domain	646	668	out -> in

Report for 3770.m00253

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)