Report for 3770.m00257

 > 3770.m00257, length: 524, copies: 1 

MSNTCLLPVVIGGVLLLSAGECSSQLASGDRDTLVAIRKGWDGVTCSDGGGGGGVVTXLSLSDMKLTWTLPAAMC

DFVNLTRLDLSNTGLPGTFPGATLYRCSQLRFLDLANNTLHGALPRDIGNLSPVMEHLNLSWNSFSGAVPPGVAA

LPALKSLHLNSNRFTGVYPAAEIGKLAGLECLTLADNAFAPAPVPVAFAKLTKLTYLWMSDMSIIGEIPEALSSL

TELTLLDLSSNNLTGAIPAWVWRHEKLECLYLFNNSLTGELPRNVMTENLIEIVLSMNQLRGEMSEDFGNLRNLT

LLSLYMNNLTGTIPASIGLLPKLSTIWLDNNNLFGELPPELGKHSPLSSIGISNNNLSGPLPETLCANGELYGIY

ASNNNFSRNLPANLGDCVLLQELVLDNNRFSGDFPEKIWLLPELEIVMIPNNFTGVLPAVLSSNIQHIEMGNNMF

SGSIPRTAIGLLVFTAENNQLDGELPADMSKLANLIELKVPDNRITGPIPASIKLLLNLKSLNLSGNQLIGAIS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	79	103	1.8
LRR [Pfam ls]	104	127	0.093
LRR [Pfam ls]	203	226	2.5
LRR [Pfam ls]	227	250	2.8
LRR [Pfam ls]	251	272	2.2
LRR [Pfam ls]	298	321	0.62
LRR [Pfam ls]	322	345	4.7
LRR [Pfam ls]	394	417	5.1
LRR [Pfam ls]	439	463	1.2

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	55	78	4.6
LRR [sensitive, ls]	55	78	110
LRR [sensitive, ls]	79	103	0.079
LRR [sensitive, ls]	79	103	1.8
LRR [sensitive, ls]	104	127	0.004
LRR [sensitive, ls]	104	127	0.093
LRR [sensitive, ls]	129	152	0.36
LRR [sensitive, ls]	129	152	8.4
LRR [sensitive, ls]	153	177	1.1
LRR [sensitive, ls]	153	177	25
LRR [sensitive, ls]	178	202	1.7
LRR [sensitive, ls]	178	202	39
LRR [sensitive, ls]	203	226	0.11
LRR [sensitive, ls]	203	226	2.5
LRR [sensitive, ls]	227	250	0.12
LRR [sensitive, ls]	227	250	2.8
LRR [sensitive, ls]	251	272	0.094
LRR [sensitive, ls]	251	272	2.2
LRR [sensitive, ls]	274	297	0.58
LRR [sensitive, ls]	274	297	13
LRR [sensitive, ls]	298	321	0.026
LRR [sensitive, ls]	298	321	0.62
LRR [sensitive, ls]	322	345	0.2
LRR [sensitive, ls]	322	345	4.7
LRR [sensitive, ls]	346	369	2.7
LRR [sensitive, ls]	346	369	63
LRR [sensitive, ls]	370	393	2.7
LRR [sensitive, ls]	370	393	62
LRR [sensitive, ls]	394	417	0.22
LRR [sensitive, ls]	394	417	5.1
LRR [sensitive, ls]	439	463	0.052
LRR [sensitive, ls]	439	463	1.2
LRR [sensitive, ls]	484	507	0.49
LRR [sensitive, ls]	484	507	12

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	41	521	5e-37
CLV2 [A. thaliana]	41	523	2e-43
Xa21 [O. sativa]	48	523	8e-42
FLS2 [A.thaliana]	51	523	3e-52
Xa21 [O. sativa]	51	517	5e-44
Cf-9 [L. pimpinellifolium]	53	243	3e-17
FLS2 [A.thaliana]	56	523	8e-57
FLS2 [A.thaliana]	56	275	2e-20
Cf-9 [L. pimpinellifolium]	59	523	2e-38
Cf-9 [L. pimpinellifolium]	59	411	4e-21
CLV2 [A. thaliana]	59	524	2e-33
CLV2 [A. thaliana]	59	412	1e-19
CLV2 [A. thaliana]	59	319	3e-15
FLS2 [A.thaliana]	59	459	1e-41
FLS2 [A.thaliana]	66	523	1e-51
FLS2 [A.thaliana]	108	523	3e-48
CLV2 [A. thaliana]	130	524	3e-36
FLS2 [A.thaliana]	133	523	6e-50
FLS2 [A.thaliana]	272	524	5e-30

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 3770.m00257

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)