Report for 3778.m00100

 > 3778.m00100, length: 1001, copies: 1 

MGLTCDTQTAKLAIILLAFILLCHGIGNVDCRGNRADQLSLLDFKKGITNDPYGALATWNTSTHFCRWQGVKCTS

TGPWRVMALNLSSQSLTGQIRSSLGNLSFLNILDLGDNNLLGSLPRLGNLKQLQALYLYKNNLTGIIPDELTNCS

SLTYIDLSGNALTGALPPNLGSLSNLAYLYLSANKLTGTIPQALGNITTLVEIYLDTNRFEGGIPDKLWQLPNLT

ILALGQNMLSGDIPFNFSSLSLQLLSLEYNMFGKVLPQNISDMVPNLQILRLDYNMFQGQIPSSLGNALQLTEIS

MANNYFTGQIPSSFGKLSKLSYISLENNSLEASDGQGWEFLHALRNCSNLELLSLAQNQLQGEIPNSIGDLPLKL

QQLVLSENKLSGEVPASIGNLQGLFRLSLDLNNLTGKIDEWVPKLTKLQKLLLHRNNFSGSIPSSIAELPRLSTL

SLAYNAFDGPIPSSLGNLSGLQKLYLSHNNLEGVIPPELSYLKQLINLSLSENKLTGEIPGTLSQCKDLANIQMG

NNFLTGNIPVTFGDLKSLGVLNLSHNSLSGTIPTTLNDLPVMSKLDLSYNRLQGKIPMTGIFANPTVVSVQGNIG

LCGGVMDLRMPPCQVVSQRRKTQYYLIRVLIPIFGFMSLILVVYFLLLEKMKPREKYISSQSFGENFLKVSYNDL

AQATRNFSEANLIGKGSYGTVYRGKLKECKLEVAVKVFDLEMRGAERSFISECEALRSIQHRNLLPIITACSTVD

STGNVFKALVYEYMPNGNLDTWIHDKEGGKAPGRLGLRQTISICVNIADALDYLHHECGRTTIHCDLKPSNILLA

DDMNALLGDFGIARFYIDSWSTSTGSNSTVGVKGTIGYIPPEYAGGGHPSTSGDVYSFGIVILELITGKRPTDPM

FKDGLDIISFVESNFPHQIFQVIDARLAEKSMDSNQTNMTLENAVHQCLISLLQLALSCTRKLPSDRMNMKQIAN

KMHSIKTTYVGLEAKKYGPACNEQDA

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	104	126	2.9
LRR [Pfam ls]	127	150	0.014
LRR [Pfam ls]	151	174	0.0027
LRR [Pfam ls]	175	198	0.045
LRR [Pfam ls]	199	222	7.4
LRR [Pfam ls]	271	294	1.7
LRR [Pfam ls]	295	318	0.33
LRR [Pfam ls]	349	372	0.042
LRR [Pfam ls]	374	397	0.24
LRR [Pfam ls]	422	445	0.14
LRR [Pfam ls]	446	469	2.4
LRR [Pfam ls]	470	493	0.0024
LRR [Pfam ls]	494	517	0.6
LRR [Pfam ls]	542	565	0.078
Ser/Thr pkinase [Pfam fs]	682	898	7.2e-42
Ser/Thr pkinase [Pfam ls]	682	973	8.9e-39

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	80	103	4
LRR [sensitive, ls]	80	103	84
LRR [sensitive, ls]	104	126	0.14
LRR [sensitive, ls]	104	126	2.9
LRR [sensitive, ls]	127	150	0.00067
LRR [sensitive, ls]	127	150	0.014
LRR [sensitive, ls]	151	174	0.00013
LRR [sensitive, ls]	151	174	0.0027
LRR [sensitive, ls]	175	198	0.0022
LRR [sensitive, ls]	175	198	0.045
LRR [sensitive, ls]	199	222	0.36
LRR [sensitive, ls]	199	222	7.4
LRR [sensitive, ls]	223	243	0.78
LRR [sensitive, ls]	223	243	16
LRR [sensitive, ls]	246	269	0.57
LRR [sensitive, ls]	246	269	12
LRR [sensitive, ls]	271	294	0.084
LRR [sensitive, ls]	271	294	1.7
LRR [sensitive, ls]	295	318	0.016
LRR [sensitive, ls]	295	318	0.33
LRR [sensitive, ls]	319	345	1.6
LRR [sensitive, ls]	319	345	34
LRR [sensitive, ls]	349	372	0.002
LRR [sensitive, ls]	349	372	0.042
LRR [sensitive, ls]	374	397	0.011
LRR [sensitive, ls]	374	397	0.24
LRR [sensitive, ls]	398	421	1.9
LRR [sensitive, ls]	398	421	39
LRR [sensitive, ls]	422	445	0.0066
LRR [sensitive, ls]	422	445	0.14
LRR [sensitive, ls]	446	469	0.12
LRR [sensitive, ls]	446	469	2.4
LRR [sensitive, ls]	470	493	0.00012
LRR [sensitive, ls]	470	493	0.0024
LRR [sensitive, ls]	494	517	0.029
LRR [sensitive, ls]	494	517	0.6
LRR [sensitive, ls]	518	541	0.73
LRR [sensitive, ls]	518	541	15
LRR [sensitive, ls]	542	565	0.0038
LRR [sensitive, ls]	542	565	0.078
LRR [sensitive, ls]	566	590	2.2
LRR [sensitive, ls]	566	590	45

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	12	792	1e-155
CLV2 [A. thaliana]	37	636	4e-60
Cf-9 [L. pimpinellifolium]	39	585	4e-57
FLS2 [A.thaliana]	40	598	1e-84
FLS2 [A.thaliana]	76	582	3e-72
FLS2 [A.thaliana]	81	981	1e-128
Cf-9 [L. pimpinellifolium]	84	593	9e-52
Cf-9 [L. pimpinellifolium]	90	603	1e-49
Cf-9 [L. pimpinellifolium]	338	598	5e-13
CLV2 [A. thaliana]	353	582	9e-16
Pto [L. esculentum]	658	930	5e-27
Rpg1 [Hordeum vulgare]	671	980	1e-24
Rpg1 [Hordeum vulgare]	675	894	6e-21

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	12	29	in -> out
putative TM domain	583	605	out -> in
putative TM domain	626	648	in -> out

Report for 3778.m00100

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)